KEGG   Callorhinchus milii (elephant shark): 103183705
Entry
103183705         CDS       T03088                                 

Gene name
nr3c1
Definition
(RefSeq) nuclear receptor subfamily 3 group C member 1
  KO
K05771  glucocorticoid receptor
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103183705 (nr3c1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cmk03000]
    103183705 (nr3c1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:cmk03310]
    103183705 (nr3c1)
Transcription factors [BR:cmk03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    103183705 (nr3c1)
Nuclear receptors [BR:cmk03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   103183705 (nr3c1)
SSDB
Motif
Pfam: Hormone_recep zf-C4 GCR
Other DBs
NCBI-GeneID: 103183705
NCBI-ProteinID: XP_007899521
LinkDB
Position
Un
AA seq 438 aa
MFCSAQAHTSSDHRPIFSVIPTFSEIAKTWDKCQSSKSTATNGVKDNYPRRAALPPKYNS
SVLKFDESTPSSSSSSGPPAKVCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCA
GRNDCIIDKIRRKNCPACRFRKCLQAGMNLDARKTKKLNKLKAPHSSSSPSTFTQPVTKS
AALVSSLLTPAMISILEGIEPDVIYASYDSTIPDTPHRLLSGLNTLGGRQMISAVKWAKT
IPGFQNLHLDDQMMLLQYSWMSLMVFSLGWRSYQYTNSNMLFFAPDLILNEDRMQQSSMY
ELCKGMHSISIEFRNLQVSYEEFLCMKTLLLLSTVPLDGLKSQAAFDEIRTCFIKELGKA
IVKREGNASQNWQRFYQLTKLMDSMHDLVGGLLQFCFYTFMESKTLSVEFPEMLVEIISN
QLPKVMAGMAKPLRFHQK
NT seq 1317 nt   +upstreamnt  +downstreamnt
atgttctgctcagcccaggcgcacaccagcagtgatcacaggcccatcttcagcgtcatt
ccaaccttctcagagattgcgaaaacttgggataagtgccagagctccaagtccactgct
accaatggtgtgaaggacaactaccccaggagagcagctttaccgcccaagtacaacagc
tctgtcctaaaatttgatgaaagcacaccttcctcttcctcctcctcggggccacctgcc
aaggtctgtctggtttgctcagatgaggcatctggatgtcattatggtgtcctaacctgt
ggcagttgtaaagttttcttcaagagagcagtagaaggacagcataactacctatgtgca
ggaagaaatgactgcataatcgacaagattcgccgaaaaaattgcccagcttgccgtttt
cgaaagtgcctccaggctggcatgaatcttgatgctcggaagacgaagaaattgaacaag
ttgaaggcacctcacagtagcagcagcccttccaccttcactcaacctgtaaccaagtca
gcagccttggtttcttcattactgactcctgccatgatctcaatcctcgaaggaattgaa
cccgatgtaatatatgcaagctatgacagcacgatccctgacacgcctcatcggcttttg
agtggactgaacacgttaggcggtcggcagatgatctcagctgtgaagtgggcaaaaact
ataccaggatttcaaaacttgcatcttgatgaccaaatgatgttgctgcagtattcctgg
atgtcactgatggttttcagccttggttggagatcctaccaatacaccaacagcaacatg
ctcttctttgcaccagatctaatcttgaatgaggacaggatgcagcaatcatcaatgtat
gaactctgcaaagggatgcacagcatctcaatagagttcagaaacttacaggtttcttat
gaagaatttctatgcatgaagactttacttttgctcagtacagtaccgttggacggcttg
aagagccaggctgcatttgatgaaattcgaacctgcttcattaaggagttgggaaaagcc
atagtgaagagagagggaaatgcgagtcaaaactggcaacgcttttatcaactgaccaaa
ctgatggattcaatgcatgatctggttggcgggttgttgcagttctgtttctataccttc
atggaatccaagactctgagcgtggagtttcctgaaatgttggtggaaattatcagcaat
cagttgcccaaagtcatggcgggaatggccaaaccgctccggtttcaccagaagtga

DBGET integrated database retrieval system