KEGG   Callorhinchus milii (elephant shark): 103184053Help
Entry
103184053         CDS       T03088                                 

Gene name
aldh2
Definition
(RefSeq) aldehyde dehydrogenase 2 family (mitochondrial)
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk00010  Glycolysis / Gluconeogenesis
cmk00053  Ascorbate and aldarate metabolism
cmk00071  Fatty acid degradation
cmk00280  Valine, leucine and isoleucine degradation
cmk00310  Lysine degradation
cmk00330  Arginine and proline metabolism
cmk00340  Histidine metabolism
cmk00380  Tryptophan metabolism
cmk00410  beta-Alanine metabolism
cmk00561  Glycerolipid metabolism
cmk00620  Pyruvate metabolism
cmk01100  Metabolic pathways
Module
cmk_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103184053 (aldh2)
   00053 Ascorbate and aldarate metabolism
    103184053 (aldh2)
   00620 Pyruvate metabolism
    103184053 (aldh2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    103184053 (aldh2)
   00561 Glycerolipid metabolism
    103184053 (aldh2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    103184053 (aldh2)
   00310 Lysine degradation
    103184053 (aldh2)
   00330 Arginine and proline metabolism
    103184053 (aldh2)
   00340 Histidine metabolism
    103184053 (aldh2)
   00380 Tryptophan metabolism
    103184053 (aldh2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    103184053 (aldh2)
Enzymes [BR:cmk01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     103184053 (aldh2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 103184053
NCBI-ProteinID: XP_007900086
LinkDB All DBs
Position
Un
AA seq 522 aa AA seqDB search
MLRALVARSPRAVGLVARGARSYSAAAAALPAPDTQPDIHYNKIFIDNDWHDAVSKKTFP
TINPSTGEIICQVAEGAEADVNNAVKAAKEAFRLGSPWRTMDASHRGVLLNRLADLIERD
KRYLASLETLDSGKPYQMTYNVDLDMVIKCYRYYAGWADKYHGKTIPADGNFFCYTRHEP
VGVCGQIIPWNFPLSMQAWKLGPALATGNVVVMKMAEQTPLTALYVANLIKEAGFPPGVV
NIIPGYGPSAGAAIASHMDVDKVAFTGSTEVGQLIQQAAGKSNVKKVTLELGGKSPNIIL
SDVDLDSAVEEAHFALFFNQGQCCCAGSRLYVQDSIYDEFVEKSVERAKRRTVGDPFDPK
NEQGPQVDEEQFGKILGYISVGKREGAKLLCGGGAAADRGYFIQPTVFGDVKDDMIIARE
EIFGPVMQILKFKTMEEVIERANDSKYGLAAAIFTNDLNKANYMSHRLRAGTVWINCYDV
LVPQAPFGGFKSSGIGRELGEDALQAYTEIKTVTVKLPQKSS
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcgcgttggtcgcccgttcaccccgggccgtcggcctggttgcccgcggggcg
aggagctactcggcggcggcggcggcgcttccagcccccgacacccagcccgacattcac
tacaacaagatttttattgataacgattggcacgatgctgttagtaagaagacctttcct
accatcaacccttccaccggggagattatctgccaggtcgccgagggagctgaggccgat
gtgaacaatgccgtaaaggcagcaaaagaagcctttcgacttggatctccgtggagaaca
atggacgcgtcacaccgaggagttctcctgaaccgcttggctgacctgattgagcgtgat
aaacgctatttggcatcgctggagaccttagacagtgggaaaccttatcaaatgacctac
aatgtggatctcgatatggttattaaatgttacaggtattacgccggctgggctgacaaa
taccatggaaagaccatccctgcagatggcaacttcttctgctacacaagacatgagcca
gttggtgtgtgtggacagatcattccgtggaatttcccattgtcgatgcaggcctggaaa
cttgggccggccctggcaacaggcaatgtggtggtgatgaagatggcggagcagactccc
ctgacggcactctacgtagcaaatctaatcaaggaggcgggattccccccaggtgttgtg
aacattattcccggctatgggccttcagcaggggcagccattgcctctcacatggacgtt
gataaagtcgcattcactggatccaccgaggttggccaactgatccagcaggcagcaggg
aaaagtaacgtgaagaaagtcacgctggagctgggcgggaagagcccgaatatcatcctc
tctgacgtggatttggacagtgcagttgaggaggcgcactttgctctgttcttcaaccag
ggacaatgctgctgtgcaggatctcgcctttatgtgcaggactccatctacgatgagttt
gtggagaagagtgtggagagagccaagcgccgcacagtgggagatccatttgacccgaag
aatgagcagggcccacaggtggacgaggaacaattcgggaagattctgggatacatcagc
gttgggaaacgagaaggagccaaactgctgtgcggaggaggggctgcagcagaccggggc
tacttcatccaacccactgtgtttggggacgtgaaggatgacatgatcatcgccagggaa
gagatctttgggcctgtgatgcagatcctgaagtttaagactatggaggaggtgattgag
cgagcgaatgacagcaaatatgggcttgcagctgcaatcttcaccaacgacctcaacaag
gcaaactacatgtctcacagactgcgagcagggacggtctggataaattgttatgatgtg
cttgtacctcaagcaccttttggtggattcaaatcttcaggcattgggcgggagcttgga
gaggacgcattacaggcttacacagaaataaaaactgtgaccgtgaagcttcctcagaag
agctcttga

DBGET integrated database retrieval system