KEGG   Callorhinchus milii (elephant shark): 103184127
Entry
103184127         CDS       T03088                                 

Gene name
fgf1
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk04010  MAPK signaling pathway
cmk04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103184127 (fgf1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103184127 (fgf1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cmk04052]
    103184127 (fgf1)
   00536 Glycosaminoglycan binding proteins [BR:cmk00536]
    103184127 (fgf1)
Cytokines and growth factors [BR:cmk04052]
 Growth factors
  Growth factors (RTK binding)
   103184127 (fgf1)
Glycosaminoglycan binding proteins [BR:cmk00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103184127 (fgf1)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 103184127
NCBI-ProteinID: NP_001279975
UniProt: K4FYM7
LinkDB
Position
Un
AA seq 152 aa
MAVTTLADLSGSLNHLPGCHNDPKLLYCENGGYFIRILPDGTVEGTRDRSDMYIQLQLQA
VSVGVVVIEGIRAKRYLAMNEKGQLHSLPSLTNECLFMESLEENSFNTYKSKEYADRNWY
VAIRKNGAAKPGQKTGHHQKAILFLPMQVTSD
NT seq 459 nt   +upstreamnt  +downstreamnt
atggccgtgacaactctggcagacttgtccggttccttaaaccaccttcctgggtgccac
aacgaccccaagctcctgtactgcgaaaacggaggctatttcatccggatcctgcccgac
ggaactgtggaagggactcgagatcgaagcgacatgtacattcagctccagttgcaggct
gtgagtgtcggagtggtcgtgatcgagggaatccgagccaaacgctacctagcgatgaac
gagaagggacaactgcactcgctgccatctctgaccaacgaatgcctcttcatggaatcg
ctggaggaaaacagtttcaacacctacaagtccaaggaatacgcagacaggaattggtac
gttgctatccgaaagaacggggctgctaaacctggacaaaagactgggcatcatcagaaa
gccatcctattcctccccatgcaagttaccagtgattaa

DBGET integrated database retrieval system