KEGG   Callorhinchus milii (elephant shark): 103184173
Entry
103184173         CDS       T03088                                 

Definition
(RefSeq) interleukin-4-like
  KO
K05430  interleukin 4
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk04060  Cytokine-cytokine receptor interaction
cmk04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103184173
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    103184173
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cmk04052]
    103184173
   00536 Glycosaminoglycan binding proteins [BR:cmk00536]
    103184173
Cytokines and growth factors [BR:cmk04052]
 Cytokines
  Interleukins
   103184173
Glycosaminoglycan binding proteins [BR:cmk00536]
 Heparan sulfate / Haparin
  Cytokines
   103184173
SSDB
Motif
Pfam: IL4 IL13 Spore_III_AB
Other DBs
NCBI-GeneID: 103184173
NCBI-ProteinID: XP_007900235
LinkDB
Position
Un
AA seq 131 aa
MTMMLKILTVLTAMLAVSYGKVDPKKHILREITKTLGHMTQDKIECGATLIPDVFSDTKG
QSASEIFCKAAEALVKIPPCESIKRHLKALRLNLAKEGEQTLSCPVNKFSEIELTTFLRK
LRKLSQQKYRQ
NT seq 396 nt   +upstreamnt  +downstreamnt
atgactatgatgctgaaaattttgactgttctcactgccatgctggctgtcagctatgga
aaggttgaccccaagaaacatatcttaagggaaatcaccaaaactctgggacatatgacc
caggacaagattgaatgtggtgctactctaatcccagatgtcttcagtgatacgaagggg
cagagtgcatcggaaatcttttgcaaggctgccgaagctctggtgaaaatacctccctgc
gagtccatcaaacgtcacttgaaggctctgagattaaacttagcgaaggagggtgaacag
actctcagctgccctgtgaataaattctctgaaatcgagctgactactttcctgaggaag
ttgaggaagctctcgcaacagaaatacagacaataa

DBGET integrated database retrieval system