KEGG   Callorhinchus milii (elephant shark): 103184426Help
Entry
103184426         CDS       T03088                                 

Definition
(RefSeq) intestinal-type alkaline phosphatase 1-like
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk00730  Thiamine metabolism
cmk00790  Folate biosynthesis
cmk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    103184426
   00790 Folate biosynthesis
    103184426
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cmk04147]
    103184426
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cmk00537]
    103184426
Enzymes [BR:cmk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     103184426
Exosome [BR:cmk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103184426
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cmk00537]
 Enzymes
  103184426
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 103184426
NCBI-ProteinID: XP_007900594
LinkDB All DBs
Position
Un
AA seq 525 aa AA seqDB search
MKTNKFLVNALILPALIYVSSCAYDPEEEDPLFWKVSAQQSLIRSFELRPLVQRAKNVIL
FLGDGMGIPTVTAARILKGQLQNRTGEETVLAMESFPHLGLSKTYNVDFQIPDSAGTATA
YLCGVKANSGTVGLSAAARRKVCNTTFGNEVESVLKRSKAAGKSVGIVTSTRVQHASPSA
NYAHSVERNWYSDADMPAEAIEAGCKDIALQLIHNVDIDVIMGGGRIYMTPAGTADPEYP
KDPTQNGIRKDKQNLIDIWLKNKEDSVYVWNKSQLDGVNVRTTKYLMGLFEPKDMKYDLN
RNSLMDPSIAEMTEKAIRILSKNPKGFFLFVEGGRIDHGHHDGKAHHALTEAVRFDEAIE
RASHFTSDFDTLSIVTADHSHVFAFGGYTFRGNSIFGLAPLRAADNMPYTGIVYGNGPGY
AIKNGSRPNISKPIIEDKEYKQQAAVPLDSETHGGEDVPIYAKGPMSHLFHNTHEEHYIA
HVMAYASCIEPYPQCSMNVWAGSGALSLSTALFSLSLAALYLLKY
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaagactaacaagtttcttgtgaacgctctaatattgcctgccttgatttatgtgtcc
tcatgtgcttacgacccagaagaggaagatcccttgttctggaaagtatcagctcaacaa
tcgttgatacgctcttttgaactccgaccccttgtccagagagccaaaaacgtcatcttg
ttcctgggagatggaatgggaattcccactgtgactgcagcacgaatcctgaaaggacaa
ttacaaaataggaccggggaggaaactgttcttgcgatggagtctttcccacatcttggt
ctgtccaagacgtacaatgttgacttccaaattcctgacagcgcgggcacagccactgcg
tacctgtgtggagtgaaagcaaactccggaaccgtgggactgagtgcagccgcccggcga
aaagtgtgcaacaccacttttggcaatgaagttgaatcagtcctgaagcgatctaaagct
gccgggaagtctgtgggcattgtgacaagcactcgtgtgcagcacgcctcaccctctgcc
aattacgcccattccgtggagaggaactggtacagtgacgccgatatgccagcagaggca
atcgaagcgggatgcaaagacattgcccttcagctcatacataatgtagacattgatgta
ataatgggaggaggaagaatatacatgactccggcaggaaccgcagaccctgaatatcca
aaagatcccacccaaaatggcattcgaaaagacaaacaaaacctgatcgacatctggctt
aaaaacaaagaagattcagtttacgtttggaataaatctcagctcgatggtgttaacgtg
aggaccaccaagtacttgatgggattgtttgaacccaaggatatgaaatatgacttgaac
cgaaattcattgatggatccatccattgctgaaatgactgagaaagccattcgaatactt
agcaagaatcccaaaggattttttctgttcgtggaaggtgggagaattgatcacggacac
catgatggaaaagcacaccacgctttgacagaggctgtgaggtttgatgaagctattgaa
agagccagtcacttcacaagtgacttcgacaccctgtctattgtcacagcggatcattcc
cacgtgtttgcttttggcggatacactttccgtggcaattcaatatttggtctggcacca
ttgagagccgctgacaatatgccatacacaggtattgtgtatggtaatggacctggttac
gcaattaagaatggaagtcgacccaacataagcaaacctataattgaggacaaggaatat
aaacagcaggctgctgttccgctggattcagaaacccacggtggggaagacgtgccaatt
tacgccaaaggtcccatgtctcatctgttccacaacacacacgaggaacattacatcgca
catgtgatggcctatgcatcttgcattgagccatacccccagtgttcgatgaacgtttgg
gctggaagtggagccctttctctctctactgctctcttcagtctttcactagcagcactt
tatttactgaaatattaa

DBGET integrated database retrieval system