KEGG   Callorhinchus milii (elephant shark): 103185867
Entry
103185867         CDS       T03088                                 

Definition
(RefSeq) protransforming growth factor alpha-like
  KO
K08774  transforming growth factor, alpha
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk04010  MAPK signaling pathway
cmk04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103185867
   04012 ErbB signaling pathway
    103185867
SSDB
Motif
Pfam: DAGAT
Other DBs
NCBI-GeneID: 103185867
NCBI-ProteinID: XP_007902798
LinkDB
Position
Un
AA seq 129 aa
MDVSLSYRSRNILGMLLVLSAVATSAQETFGDCLEFYTDFCLHGSCKLLISEHLASCTCS
RGFVGSRCQYFDLLAVVSEDPNTQKIVVFAMIPVLVISVAATVCFCLNLCKCKKWSPKMT
DCCCSGMNI
NT seq 390 nt   +upstreamnt  +downstreamnt
atggatgttagccttagctacaggtcaaggaacatattaggaatgctgctagttctctca
gctgtagccacaagtgctcaggagacatttggggactgtctggaattctacacagacttt
tgtttacatggctcctgtaaacttctgatttctgaacacctggcatcttgcacatgttca
agaggctttgttggcagcaggtgtcagtattttgacctcctagctgtagtgtctgaggat
ccaaacacacagaaaatcgtagtctttgctatgattcctgtcttggttatcagtgtggct
gctacagtctgcttctgtctaaacctctgtaaatgtaaaaagtggagtcctaaaatgaca
gactgctgttgctctggtatgaatatataa

DBGET integrated database retrieval system