KEGG   Callorhinchus milii (elephant shark): 103186597Help
Entry
103186597         CDS       T03088                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk00052  Galactose metabolism
cmk00500  Starch and sucrose metabolism
cmk01100  Metabolic pathways
cmk04142  Lysosome
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    103186597
   00500 Starch and sucrose metabolism
    103186597
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    103186597
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cmk04147]
    103186597
Enzymes [BR:cmk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     103186597
Exosome [BR:cmk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103186597
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 103186597
NCBI-ProteinID: XP_007903917
LinkDB All DBs
Position
Un
AA seq 1005 aa AA seqDB search
MKVDGGSAFRLSDVIGSVFCCLFTLPDRSTGREGLVGVGELLKGPLHFPLWLSGKGNIAV
RLDQCAKAMSRQVELLWEGAVSPVQREAGKPEIVPRWRRWLLLLLALALLLGFAQLLPGT
LTLRGPEWQPRQLARESWQGGDGGGRGPVGLAGCGSVPEARQFDCYPERDTVVTRKLCQA
RGCCFVQVLRRLSGVPWCFYPPTFPTYTLTNLSQTPLGETGVLTRSQKSYYPNDVLNLQL
DVTFETNTRLHIKIRDSRSHRYEVPIEVPPPAHRAPAPTYTVQYSPKPFGLIVTRKSTGA
VLLNTTLAPLLFADQFLQISTSLPSPYIYGLGEHQAGFLHTVQWNTLTFWARDCPPRDFV
NLYGVHPFYLSIEPNGTSHGVFLLNSNAMDVVLQPVPALTWRTIGGVLDFYIFMGPDPNS
VIQQYLEVVGRPAMPPAWGLGFHLCRWGYRTSNRTWQVVKEMRDAGIPQDVQWNDIDYMD
RYLDFTFDARTFDSLPDLVKDLHDHRQRYVMILDPGISSTQTPGTYWPYDEGLKRGVFIN
NATGNPLIGQVWPGLTAFPDFSDPKTQGWWYENLLRYHQAVPFDGVWIDMNEPSNFLDGS
TEGCPSDRFENPPYVPGVLGGQLRSKTICASAKQSVSLHYNVHSLYGLMEAKATASALIK
ILNKRPFVISRSTFPSQGKYSGHWLGDNRSQWKDMYYSIPGILNFNMFGIPLVGSDICGF
GDTTTEEMCVRWTQLGAFYPFSRNHNMLGTKAQQPTAFSTSAQAAMRTALRTRYSLFPFL
YTLFHRAHVLGQTVARPLLFEFPEDVNTFSVDRQFLWGRSLLITPVLEPGADSVTGYFPK
GLWFDFYTGTALSSSGEHRKLAAPLDIINLHIREGSIIPAQEPNTTIWDSSSNPLYLMVG
LTPQGTAQGDIFWDDGESLDTYESGNYTYVTFSVAENTLTSTVLHLNVEGTYLGVETLMV
FGLKLQPVRVTVNGKSVSFNYSANQVLTVNHLDLLLSKEFHILWQ
NT seq 3018 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtggatggcggcagcgctttcagactatccgatgtgattggtagtgttttctgc
tgcctgtttactcttcctgatcggagtacagggagggagggtctggtcggtgtgggggag
ctgttaaagggacctttacactttcctctctggctctcgggtaaaggcaacattgcagtc
cgtctcgaccagtgtgcgaaggcgatgtccaggcaggtggagttgctgtgggaaggtgcg
gtttcaccggtacaaagggaggcgggcaagcccgagattgtcccccgttggcggcgatgg
ttactgctgctgcttgccctcgctctcctcctggggtttgcccagctcctgcccggcact
ctgaccctccgggggcccgagtggcagccccgacagctggcaagagagagctggcaaggg
ggtgacggcggggggagggggccggtggggctggcagggtgtgggtctgtcccggaggcc
aggcagtttgactgctaccccgagagggatacggtggtgacccggaagctgtgccaggct
cgcggctgctgctttgtgcaggtacttcgcagactgtccggggttccctggtgtttctac
cctcccaccttccccacttataccctgacaaacctgagccaaaccccgctgggggagact
ggagttctaacccgcagccagaaatcctactaccccaacgacgtgctcaatctccagctg
gacgtcacctttgagaccaacaccaggctccacatcaagatccgtgactcccgcagccac
cggtacgaagtcccgatcgaggtgcccccgcccgcccaccgagcccccgcccccacctac
acggtgcagtactccccaaagccgttcgggctgatcgtcaccaggaaatccacaggagcc
gtgctgctgaacaccacgctggctcctctgctcttcgccgaccagttcctgcagatctcc
acgtcgttgccgtccccttacatctatggtctgggggagcaccaggccggcttcctgcac
accgtccagtggaacacgctgactttctgggctcgggactgcccccccagggactttgtt
aacctgtatggagtccatcccttctacctgtccatcgagcccaatggcacatcgcacggt
gtcttcctgctcaacagcaacgccatggatgtggtcctgcagcctgtaccagccctgacc
tggagaacaataggaggcgtcctagacttctacatattcatggggcccgaccccaattct
gtcatccaacaatatctagaggtcgtaggtcgccccgccatgccccccgcatggggtctc
ggcttccacctctgccgctgggggtacaggaccagtaacagaacctggcaggtggtcaag
gaaatgagagacgccggcattccacaggacgtacagtggaatgacatcgattacatggat
cgttacctggatttcacctttgacgcccggacatttgacagccttcccgacctggtgaag
gacctgcacgaccacagacagagatacgtcatgatcctggaccctggcatcagcagcact
cagacacctgggacctactggccctacgatgagggtctgaaacgtggcgtcttcattaac
aacgcaactgggaacccgctgatcggacaggtgtggccgggactcacggcgttcccagac
ttcagtgaccccaagacccagggctggtggtacgagaatctcctgcggtatcaccaggcg
gtgccgttcgacggcgtgtggattgacatgaacgaaccttccaatttcttggacggatct
acggaaggctgcccgtcagaccggtttgaaaatccgccgtacgtaccaggagtgcttggt
gggcaactgcggagtaagactatatgtgcctctgcaaagcagagcgtgtctctgcactac
aatgtgcacagtctgtacggactgatggaagcaaaggcgactgcaagcgctttgattaag
attctcaacaagcgtccgtttgtaatttctcgatccaccttcccaagtcaaggcaagtac
tcggggcattggctgggagacaacaggagccaatggaaggacatgtactactccatccca
ggaatcctgaattttaacatgttcgggataccgctggttggctcggacatctgcggcttt
ggtgacacgaccaccgaggagatgtgtgtccgctggacgcagctcggggctttctacccg
ttctcgcgcaaccacaacatgctgggcaccaaggcccagcagcccacagctttcagcacc
tcggctcaggccgccatgaggacagccctgaggacccgctattcccttttcccgtttctc
tacacgctgttccaccgggcgcacgtactgggccagaccgtggccagacctttgctcttc
gagtttcccgaggatgtcaacacgttctccgtggacaggcagttcctgtggggtcggagc
ctcctcatcaccccggtgctggagccaggagcagactcggtgactggctacttccctaaa
ggcctctggtttgacttttacaccggcacggctctcagcagcagtggggagcacaggaag
ctggcggcccctctggacatcataaacctgcacattagagaaggcagcatcattcccgca
caggaacccaacacgaccatctgggactccagcagcaaccctctgtacctgatggtgggg
ctgaccccccagggcactgcgcaaggagacatcttctgggacgacggggaaagtttggac
acctacgagagcggcaattacacttacgttacgtttagtgttgctgagaacacattgacc
tccacagtgctgcacctgaatgtcgagggaacctacctgggggtggaaaccctgatggtg
tttgggctcaaactccagccagtcagggtcacagtgaacggcaagtccgtttccttcaac
tactcggcaaaccaggtcctgactgtcaatcacctggaccttctcctcagtaaagagttc
cacatcttgtggcagtga

DBGET integrated database retrieval system