KEGG   Callorhinchus milii (elephant shark): 103186688Help
Entry
103186688         CDS       T03088                                 

Gene name
hdac4
Definition
(RefSeq) histone deacetylase 4
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103186688 (hdac4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cmk03036]
    103186688 (hdac4)
Enzymes [BR:cmk01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     103186688 (hdac4)
Chromosome and associated proteins [BR:cmk03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     103186688 (hdac4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln TFIIA
Motif
Other DBs
NCBI-GeneID: 103186688
NCBI-ProteinID: XP_007904060
LinkDB All DBs
Position
Un
AA seq 1090 aa AA seqDB search
MTSQSHPDGSSGRDQSVELLTPTRLNHMPSTVDASTALPPPVQSSTLMDLRLDQQFTVPP
ADPNVREQQLQQELIALKQKQQIQRQLLIAEFQRQHEQLSRQHEAQLQEHIKQQQELLAL
KHQQEILEQQRKLEQHRQEQEMEKQHREQKLLLLKNKEKGKESAVASTEVKLRLQEFVLN
KKKAAAHRAINHSLPNDPRVWYGKTQHGSLDQSSPPQSSVSASYNHPVLGMYDPKDDFPL
RKTASEPNLKVRSRLKQKVAERRSSPLLRRKDGSAITTLKKRPVDVPDSVCNSAPGSGPS
SPNNSSNNITTENGIAGTATSIPTESTLAQRLVTRDGLITQMPLYTSPSLPNITLGLPAT
GPSSGVSGQVDGERLGMPALQQGLPLNTSFIAGTHLPHYLTTTLDKDANTGHAPLLQHMV
LLDQSTPQSPLVTDWYLSGLGALPIHPQSLVGPDRVSPSIHKLRQHRPLGRTQSAPLPQN
AQALQQLVIQQQHQQFLEKHKQQFQQQQIHINKLIPKPNEQARQHESHPEETEEELREHQ
AMPDEPYSERSPNQSECVSLKKMVQVKQEPIESDEDDEEQRELEQRKRHAEQQQELLFRQ
QALLLEQQRIHQLRNYQASMEAAGIPISYAGHRPLSRAQSSPATATFPITVQEPPSKPQF
TTGLVYDTLMLKHQCTCGNTNRHPEHAGRIQSIWSRLQETGLRSKCECIRGRKASLEELQ
TIHSEQHTLLYGTNPLNRQKLDSSVTPMFVMLPCGGLGVDSDTIWNEIHSSSAARLAVGC
VIELVFKVASKELKNGFAVVRPPGHHAEESTPMGFCYFNSLAIATKLLQHRLNVSKILIV
DWDVHHGNGTQQAFYSDPNVLYISLHRYDDGNFFPGSGAPDEVGTGPGVGFNVNMAWTGG
LDPPMSDAEYLTAFRTVVMPIANEFAPEMVLVSSGFDAVEGHPAPLGGYKVSAKCFGYLT
KQLMGLAGGRVVLALEGGHDLTAICDASEACVSALLGNELEPFTQEVLQQRPNPNAVHSI
ENVIEIQSKYWRSLERFSSTVGYSLIEAQKCDNEEAETVTAMASLSMEVKQGAGAVKRPD
DEPMEEEPPM
NT seq 3273 nt NT seq  +upstreamnt  +downstreamnt
atgacctcacaaagccatccagatggatcctccggcagagaccagtctgtggagttgttg
acgcccaccagattgaaccacatgcccagtactgttgatgcaagcacagcactgcctcct
ccagtccagtccagcacactaatggatctccggctggatcaacagttcacagtgccacct
gcggaccccaatgttcgagaacagcaactgcagcaggaactgatagctctgaaacagaaa
caacaaatccagcgtcagctgcttatagcagagtttcaaaggcaacatgagcagctctcc
cggcaacatgaagcccaactgcaagagcacatcaagcaacagcaggagttgcttgcactg
aagcaccagcaagaaatcttggaacaacagcgtaaactggaacagcatcgccaggagcaa
gagatggagaaacaacatcgagaacaaaagctgttgctgctaaagaataaagagaaagga
aaagaaagtgcagtagcaagcacagaagtgaaactgagacttcaggagtttgtgctgaat
aaaaagaaagctgcagcacacagggcaataaaccattccctcccaaatgacccaagagtt
tggtacggaaaaacccagcatggctcactggaccagagttctccacctcagagcagtgtg
tctgcctcgtacaatcacccagttctaggaatgtacgatcccaaagatgacttcccactc
agaaaaacagcatctgagccaaacttaaaggtacgatccaggctaaagcagaaagtggca
gagagaaggagtagccctttactaaggagaaaggacggaagtgctataaccacgcttaaa
aagagacccgtggatgttccagactcggtatgtaacagtgctcctggatctggcccgagc
tcacccaacaacagctccaacaacatcactacagagaatggtatagccggaactgctacc
agcataccaactgagtctaccttagctcagaggctggttacccgagatggcctaataaca
caaatgcctctgtatacgtcaccatctttgcccaacatcaccttaggtttgccagcaaca
ggtccctccagcggagtctcaggtcaagttgatggtgaaaggttgggtatgccagctctc
cagcaagggctcccattgaacacttcatttattgctggtactcatctgccacactaccta
acaacaacattggacaaagatgccaatactggtcatgctcctctcttacaacacatggtt
ttactggaccagtctacaccacagagtccattagtaactgactggtatctttcaggattg
ggagcattgcccattcacccacagtcgcttgtcggcccagaccgagtttcaccttccata
cacaagcttaggcagcaccgtccactaggcaggacacagtcagcaccactgccacagaat
gcacaggccttgcagcagctggtcatccagcagcaacatcagcagttcctggagaagcat
aaacagcagttccaacagcaacagatccatatcaacaagcttatcccaaagcccaacgaa
caggccaggcagcatgaaagtcatccagaagaaaccgaggaggaactccgagagcaccag
gcgatgcctgatgagccatactcagagcggagccccaaccaaagcgaatgtgtatccctg
aagaagatggtgcaggtgaaacaggaacccattgagagcgatgaagatgatgaagagcag
cgagagctggagcaacgaaaaaggcatgcagagcaacaacaggaacttcttttcagacag
caagcccttctgctggaacaacagcgcattcatcagcttcgcaattaccaggcatcgatg
gaggcagcagggatcccaatctcctatgctggccaccgccccctctcccgggcacagtcc
tcacctgctactgctactttccctattaccgttcaggaacctcccagtaaaccccaattc
actacaggacttgtgtacgatacgctgatgctgaaacaccagtgcacctgcggcaacaca
aatcggcacccagagcatgccgggaggatccagagcatctggtcccgactccaagagaca
gggttgcggagcaaatgtgagtgtatccgaggaaggaaagcatcgcttgaagaactgcag
acaattcactcggagcagcacacattactgtatggcacaaatccactgaaccggcagaag
cttgacagttcggtcaccccgatgtttgttatgctcccgtgcggtgggctcggagtggac
agtgacacaatttggaatgagatccactcatctagtgctgcccgtttggctgtgggctgt
gtgatcgagcttgtgtttaaagtggcctccaaggaattaaagaatgggtttgcagttgtc
cgacctcctggacaccatgcagaggaaagcacgccgatgggattctgctacttcaattct
ctggccattgcaaccaaactactccagcacagattgaatgtcagcaagatccttatagtg
gactgggatgtgcatcatggtaatggtacccagcaggctttctacagcgaccccaatgta
ctgtacatttcacttcatcgctatgacgacgggaacttcttcccaggcagtggtgcccca
gacgaggttgggactggtcctggtgtaggatttaacgttaatatggcttggactggaggc
ctggatccaccaatgagcgatgctgagtacttgactgcatttaggacggtggtgatgccc
attgccaatgaatttgctccggaaatggtattggtgtcctctggatttgatgcagtggaa
ggacatcctgctccccttggaggttataaagtttctgctaaatgttttggctatctcacc
aaacagctgatgggcctggctggaggccgtgtcgtgctagccctggaagggggccacgat
ctgactgccatttgtgatgcctcagaagcatgtgtttctgctttacttggaaatgagctt
gagcctttcacacaagaagttctgcaacagagaccgaaccctaacgctgtccactccatt
gagaatgtaatcgagatacaaagtaagtactggaggtcactggaacgcttctcttccaca
gtgggctactcgctgatagaggcccagaaatgtgataatgaggaagctgagactgtgaca
gctatggcttcactgtcgatggaagtcaaacaaggagctggtgctgtgaagaggccagat
gatgagcccatggaggaagagccacctatgtag

DBGET integrated database retrieval system