KEGG   Callorhinchus milii (elephant shark): 103186853Help
Entry
103186853         CDS       T03088                                 

Gene name
mapk6
Definition
(RefSeq) mitogen-activated protein kinase 6
  KO
K06855  mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
cmk  Callorhinchus milii (elephant shark)
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cmk01001]
    103186853 (mapk6)
Enzymes [BR:cmk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     103186853 (mapk6)
Protein kinases [BR:cmk01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   103186853 (mapk6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo
Motif
Other DBs
NCBI-GeneID: 103186853
NCBI-ProteinID: XP_007904296
UniProt: V9K8Y4
LinkDB All DBs
Position
Un
AA seq 734 aa AA seqDB search
MAEKFESLMNIHGFDLGARYMDLKPLGYGGNGLVFSAVDNDCDKRVAVKKIVLSDPQSVK
HALREIKIIRRLDNDNIVKVFEILGPSGIPMSDDVGSIPELNSVYIVQEYMETDLAKLLE
QGQFSEEHARLFMYQLLRGLKYIHSANVLHRDLKPANLFINTEDLVLKIGDFGLARIMDP
HYSHKGHLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCIFAEMLTGKTLFAGAHELEQ
MQLILNTIPVVHEEDRQELLHVIPVYIKSDMTEPHNPLPELLPGIGPEALDFLEQILTFN
PMDRLTAEEALAHPYMSIYSFPMDEPKSAHPFHIEDEVDDMLLMDESHSHIYNWDRYHES
ELSDHDWTLHGNFEADDVQRDPRAMSDMTEEEEVQVDPRKYMDGDREKYLEDPAFDLNFS
TEHSWPHPDHHENKYCDLECGQTCNYKVGSPSYLDNLVWRETEVNHYYEPKLIIDLSNWK
EQIKEKPDKKSKTKCERNGLVKAQLALVEASQQIVEKDKEKDHSFDFDSFIAGTIKLSLQ
PESPDVDKLNDLNSSVSQLDLKTSMSNCKSVSQEKEEKGIANLAQLECRSQNPWESQIGN
GGSAGVDESCIINLEEEVCWDTRKDEQLEKENTFTSYLDKFFSKKEDPEMAESEPVDERK
QADRASEENAKASNRNGEIPFSKQLESIGIPQFDNPVGSPLKSRAIQATLAPPAAKLSPQ
IPHKAYSNILKHLN
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaagtttgaaagtttaatgaacattcatggttttgatttgggtgctcggtat
atggacttgaagccactcgggtatggaggcaatggtctggttttctctgctgtggacaat
gactgtgacaagcgagtggctgtcaagaaaattgtcctgagtgacccccagagtgtcaaa
catgccttacgggagatcaaaatcatccgacgacttgacaatgataacatagtgaaagtt
tttgagattttgggtccaagtggtataccgatgtctgatgatgtgggttccatcccagaa
ctgaattcagtatacattgttcaggagtacatggagacggatctagcaaagttgttggaa
cagggccaattctcagaagagcatgctaggctcttcatgtaccagctgcttcgtgggcta
aaatacatccattcggctaatgtgctgcacagagatctcaaaccagctaatctcttcatt
aacactgaggatttggtgttgaaaataggggattttggtctggcacgcatcatggatccc
cattactctcacaaaggccatctatctgagggcttggtcacaaagtggtacagatctcca
cgcctccttctctctcccaacaactacaccaaagccattgacatgtgggctgctggctgt
atctttgcagaaatgctgactggaaaaacactttttgcaggtgctcatgagctggagcag
atgcagttgattctcaatactatccctgttgtccacgaagaagatcgacaggagctcttg
cacgtgatcccagtttacataaaaagcgacatgactgagccacacaatccattgccagaa
ctacttcctggcatcggacctgaagcattagattttctggaacaaattttgaccttcaat
ccaatggacagactgacagcagaggaagccttggcacatccatatatgagtatttattcc
ttcccgatggatgaacccaagtccgctcacccctttcacattgaggatgaggttgatgac
atgttgcttatggatgagagtcacagccacatttacaattgggacagatatcatgaaagt
gaattgtcagaccatgattggactttgcatggtaattttgaggcagatgatgttcagcgt
gacccgcgagcaatgtctgacatgaccgaggaagaggaggtgcaagtggaccctcgcaag
tatatggacggagaccgtgagaagtatttggaggatcctgcctttgacttgaacttttcc
actgaacattcttggccacatccagatcaccatgaaaacaaatactgtgatctggaatgc
gggcaaacctgtaactataaagttgggtccccatcctacttggataacttagtatggagg
gaaactgaagtcaatcattactatgagcccaagcttattattgacctatctaactggaaa
gaacagatcaaagagaagccagataaaaagagcaagacaaagtgtgaacggaatggattg
gtgaaagcacagttagctctagtggaggcatcgcagcagatagttgagaaggacaaggag
aaggatcatagctttgactttgattctttcattgcaggcaccatcaagcttagcttgcag
ccagagtctcctgatgtagacaagctcaatgacttgaacagctcagtgtctcagttggac
ctgaaaacttcaatgtctaactgcaagtctgtcagtcaggagaaagaggagaaggggatt
gctaatttggcgcagctagagtgccggagccagaatccatgggaaagtcaaattggaaac
ggaggaagtgctggcgtggatgagagctgtataatcaatctagaagaagaggtttgttgg
gacacaaggaaggatgaacagctagagaaagaaaacacattcactagttacttagacaag
tttttcagcaaaaaagaggaccctgaaatggcagaatctgagccagtagatgagaggaag
caggcggatcgagccagcgaagagaatgcgaaagcgagcaatagaaatggagaaatcccg
tttagcaaacagttagaatctataggtattcctcagtttgacaaccctgtcggttcaccc
ctgaaatctagagcaattcaggctacattagcaccacctgctgcaaaattgtctcctcag
attcctcataaagcctatagtaacatcttgaaacatctgaactga

DBGET integrated database retrieval system