KEGG   Callorhinchus milii (elephant shark): 103187005Help
Entry
103187005         CDS       T03088                                 

Gene name
ezh2
Definition
(RefSeq) enhancer of zeste 2 polycomb repressive complex 2 subunit
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    103187005 (ezh2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cmk03036]
    103187005 (ezh2)
Enzymes [BR:cmk01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     103187005 (ezh2)
Chromosome and associated proteins [BR:cmk03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     103187005 (ezh2)
   Polycomb group proteins
    PRC2-EZH2 complex
     103187005 (ezh2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET EZH2_WD-Binding
Motif
Other DBs
NCBI-GeneID: 103187005
NCBI-ProteinID: XP_007904509
UniProt: V9KET3
LinkDB All DBs
Position
Un
AA seq 762 aa AA seqDB search
MGFTGRKSTKGPVCWRKRVKSEYMRLRQLKRFRRADEVKSRFSANRQKIKEKTEILNQDW
KQHRIQPVHIMTSVSTMRGTRECTVESGFPEFSKQIIPLKTLNAVASIPVMYSWSPLQQN
FMVEDETVLHNIPYMGDEILDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALT
QYSDNDEEDEDDDEDQENKSEKTDGSDIKEESNEARKDYQDISMDGKESEEGKKMPCDKI
FEAISSMFPDKGTPEELKEKYKELTEQQLPGALPPECTPNIDGPNAKSVQREQSLHSFHT
LFCRRCFKYDCFLHPFHATPNTYKRKNPETRAETEHCGSDCCLYLDGAKDFAVALTAERI
KTPPKRPGGRRRGRHPNSTSRPSTPTINLSEAKDTDSDREAGTDTGGEINDKDEEDKKDD
TTSSSEANSRCQTPVKMKLTADLSDVEWSGAEASLFRVLHGTYYNNFCAIAKLLGTKTCR
QVYEFAVKESNIIARVPAEDADTPPRKKKRKHRLWAAHCRKIQLKKDGSSNHVYNYQPCD
HPRQPCDSSCPCVMAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDL
CQTCGAADHWDSKNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKEPVQKNEFISEYCGE
IISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNG
DHRIGIFAKRAIQTGEELFFDYRYSQADALKYVGIEREMEIP
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atgggatttactggtagaaaatctactaaaggaccggtttgttggcggaagcgggttaag
tctgaatatatgcgccttcgacagctgaagcgttttagacgagcagatgaagtgaagagt
aggtttagtgcaaatcggcaaaagatcaaggagaaaactgaaattttgaaccaggattgg
aagcagcatcggatacagcctgttcacatcatgacctcagtgagcacaatgcggggtacc
agagagtgtacagtggagagtggattccctgaattttcaaagcaaatcatccccctgaag
acactgaatgcagttgcctcaattccagttatgtattcctggtctccacttcagcagaat
ttcatggttgaagatgagactgttctccataacattccttatatgggtgatgaaatcttg
gatcaagatgggactttcattgaggaacttattaaaaattacgatggaaaggtgcatgga
gaccgagaatgcggctttatcaatgatgagatctttgtagagctggttaatgctctgact
cagtacagtgataatgatgaagaggatgaagatgatgatgaagatcaggagaataaatct
gagaagactgatgggagtgacatcaaagaagaaagcaatgaagcaagaaaagactatcag
gatatcagtatggatggtaaagagagtgaagaagggaaaaaaatgccctgtgacaagatc
tttgaagcaatttcatctatgttcccagataaaggtacaccagaggagctgaaagaaaag
tataaagagctgacagaacaacaacttcccggagcacttcctccagaatgcacaccaaac
attgatggaccaaatgctaaatctgttcaaagagaacaaagcttgcattctttccacacg
ctcttctgcagacgttgcttcaaatatgattgtttcttacatcctttccatgctactcca
aatacatacaaacgtaagaatccggagaccagagcagaaacagaacactgtggatcagat
tgctgtttatatctggatggagcaaaggactttgctgttgccttgacagctgagcgaata
aaaacaccaccaaagcgcccaggaggccgaagaagaggtcgtcacccgaacagcacaagt
cgacccagtacaccaacaataaacctatctgaggctaaagatacagatagtgacagagag
gctgggacagatactggaggggagataaatgacaaagatgaagaggacaagaaggatgat
accaccagctcatctgaggcaaactccagatgtcaaacccctgttaagatgaaactgact
gcagatctctctgatgtggagtggagtggagctgaagcctcactctttagagttctacat
ggcacttactacaataacttctgtgccattgccaagttgttaggaaccaaaacatgtaga
caggtgtatgagtttgctgtgaaggagtctaatatcattgcccgtgtccctgcagaggat
gccgatacaccaccaaggaagaagaagcgaaagcacagattgtgggctgcacattgcaga
aagatacaattaaaaaaagatggttcatcaaatcatgtttacaactaccagccttgtgac
cacccacgtcagccctgtgacagctcttgtccttgtgtcatggctcaaaatttctgtgaa
aagttctgtcagtgcagctctgagtgtcagaacagatttcctggctgccgttgcaaggct
cagtgcaataccaagcagtgcccttgctatcttgcggtgcgtgaatgtgatccagaccta
tgccaaacctgtggagccgctgaccactgggacagtaagaacgtctcctgtaaaaactgc
agcattcagagagggtccaaaaagcacttattgctggcaccctctgatgtggctggatgg
gggattttcatcaaagaaccagtgcagaaaaacgaattcatctctgagtactgtggagag
atcatatctcaggatgaggctgaccgccgaggcaaggtgtatgacaagtacatgtgcagt
ttcctcttcaacttgaataatgactttgtggttgatgcaacacgcaagggtaacaaaata
cgttttgcaaatcattcagtcaatcctaattgttatgccaaagtaatgatggttaatgga
gaccaccgaataggcatttttgctaaaagagcaatccagactggagaagagttattcttt
gactacaggtatagccaagctgatgccctgaaatatgttggtatagaaagagaaatggaa
atcccatga

DBGET integrated database retrieval system