KEGG   Callorhinchus milii (elephant shark): 103187447Help
Entry
103187447         CDS       T03088                                 

Gene name
sdhb
Definition
(RefSeq) succinate dehydrogenase complex iron sulfur subunit B
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk00020  Citrate cycle (TCA cycle)
cmk00190  Oxidative phosphorylation
cmk01100  Metabolic pathways
cmk01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    103187447 (sdhb)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    103187447 (sdhb)
Enzymes [BR:cmk01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     103187447 (sdhb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer2 Fer4_7
Motif
Other DBs
NCBI-GeneID: 103187447
NCBI-ProteinID: NP_001279951
UniProt: K4GLL2
LinkDB All DBs
Position
Un
AA seq 279 aa AA seqDB search
MAGVCLWRKGSVWLPLRAACLLQASRSAATEAAPATRIKKFAIYRWNPDKPGDKPRMQTY
EIDLNTCGPMVLDALIKIKNEMDSTLTFRRSCREGICGSCAMNINGGNTLACTCKIDTNI
NKVSKIYPLPHMYVVKDLVPDLSNFYAQYKSIQPYLKKKDESQEGKQQYVQSIEDRQKLD
GLYGCILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDEFTEERLAQLQDPFSLY
RCHTIMNCTQACPKGLNPGKAIAEIKKMMVVYKTKAANA
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgtttgcttgtggaggaagggaagcgtctggttaccgctgagggcggcgtgt
ctgctgcaggcatctcgcagcgcagccactgaggctgcacccgccactcgaattaaaaag
tttgcaatttacagatggaatccagacaaaccgggtgataagccacgcatgcagacctat
gagattgatctgaacacgtgtggcccaatggtcctggatgctctcattaagatcaagaat
gagatggattccacactgacgttccgcagatcgtgcagagagggcatctgtggctcctgt
gccatgaatatcaatggtggaaacacacttgcttgcacctgcaagattgacaccaacatc
aacaaagtatcaaagatctatcccttacctcatatgtacgtggtgaaggaccttgtgccg
gacttgagtaacttctatgcacagtacaagtcaattcagccttacctgaagaagaaggac
gagtcacaggagggaaagcagcaatatgtgcaatctattgaagaccgacagaaactggat
ggcctgtacggatgtattctctgtgcgtgctgcagcaccagttgcccaagttattggtgg
aacggggataagtacttagggcctgccgtcctcatgcaggcgtatcgctggatgatcgac
tcccgagatgagtttacggaggagcgtctggctcagctgcaggatcccttctctctctat
cgctgtcacactatcatgaattgcacacaggcttgccccaagggtttgaacccagggaaa
gcaattgctgaaattaagaagatgatggtagtttacaagaccaaggctgcaaatgcatag

DBGET integrated database retrieval system