KEGG   Callorhinchus milii (elephant shark): 103187816Help
Entry
103187816         CDS       T03088                                 

Gene name
ogdh
Definition
(RefSeq) oxoglutarate dehydrogenase
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk00020  Citrate cycle (TCA cycle)
cmk00310  Lysine degradation
cmk00380  Tryptophan metabolism
cmk01100  Metabolic pathways
cmk01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    103187816 (ogdh)
  09105 Amino acid metabolism
   00310 Lysine degradation
    103187816 (ogdh)
   00380 Tryptophan metabolism
    103187816 (ogdh)
Enzymes [BR:cmk01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     103187816 (ogdh)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 103187816
NCBI-ProteinID: XP_007905667
LinkDB All DBs
Position
Un
AA seq 1035 aa AA seqDB search
MHRLRTCAAKLRPLTASQTIKTLSHNGPAVSRTFQQGRFYTLPVAAEPFLSGTSSNYVEE
MYFAWLENPQSVHKSWDIFFRNANAGALPGTAYQSPPPLGTSLATLTHAGVKAQPNVEKL
VEDHLAVQSLIRAYQIRGHHVAQLDPLGILAADLDSSVPGDLVTASNGIDVAVCEDRLRK
LTVGGFYGLHESDLDKVFHLPTTTFIGGNESALALREIIRRLEMAYCQHIGVEFMFINDL
EQCQWIRQKFETPGVMQFTNEEKRTLLARLVRSTRFEEFLQRKWSSEKRFGLEGCEVLIP
ALKTIIDKSSESGIDNVIMGMPHRGRLNVLANVIRKELEQIFCQFDSKLEASDEGSGDVK
YHLGMYHRRINRVTNRNITLSLVANPSHLEAADPVVQGKTKAEQFYLGDTEGKKVMSVLL
HGDAAFAGQGIVYETFHLSDLPSYTTHGTVHVVVNNQIGFTTDPRVARSSPYPTDVARVV
NAPIFHVNGDDPEAVMYVCNVAAEWRNTFHKDVVVDLVCYRRNGHNEMDEPMFTQPLMYK
QIKKQKAVLKKFAEKLMAEGVVNQQEFEEEMAKYDKICEEAYTRSKDEKISHIKHWLDSP
WPGFFTLDGQPKSMSCPPTGLNEEMLEHIGKIASSVPEEDFTIHGGLTRILKGRAEMIKN
RTVDWALAEYMALGSLLKEGIHVRLSGQDVERGTFSHRHHVLHNQNVDKKTCIPMNHLWP
NQAPYTVCNSSLSEYGVLGFELGFAMASPNALVLWEAQFGDFHNTAQCIIDQFICPGQAK
WVRQNGIVLLLPHGMEGMGPEHSSARPERFLQMCNDDPDVVPKVTDDFAVRQLYDSNWIV
VNCSTPANYFHVLRRQILLPFRKPLIIFTPKSLLRHPDAKSSFDAMFSGTEFLRAIVEEG
PAAQSPEQVKRLLFCTGKVYYELAKERKSRGMEAEVAITRLEQLSPFPFDLVDQEAGKYS
QAELVWCQEEHKNQGYYEYVKPRIRSTTHRTRPVWYCGREPASAPATGNKNTHLHELKRF
LDTSFNLESFKHLEN
NT seq 3108 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgattaaggacttgtgctgctaaactgaggccattgactgcctcgcagactata
aaaacattgtcacacaatgggccagcagtgtctaggacgtttcagcaaggccgtttctac
actttgcctgtagctgctgagcctttcctgagtgggactagttcgaactatgttgaggaa
atgtactttgcctggcttgaaaatccccaaagtgtccacaagtcttgggatatatttttc
cggaatgccaatgcaggagcgttaccgggtacagcgtaccaaagcccccctcccctgggc
accagcctggccaccctgacccatgctggagtaaaagcacaaccaaatgtggagaagttg
gtggaggatcatctggcagtgcagtcgctgatcagagcttatcagatacgagggcatcac
gtagctcagctggatccactaggaattctggctgcggacctggattcgtccgtaccagga
gacctagtcaccgcctcaaacggaattgacgttgctgtctgcgaggatcgcctgagaaag
ttgacggtaggaggcttttacggcctccacgagtctgatctggacaaggtcttccattta
cctacaactaccttcattggaggcaacgagtctgcccttgctcttcgggagatcattcgg
aggctggagatggcttactgccagcacattggtgtggagttcatgtttatcaatgacttg
gagcaatgccaatggatcagacagaagtttgagactcctggggtcatgcagttcaccaat
gaggagaagaggacccttctggcgaggctggtccgctccaccaggtttgaggagtttctg
cagaggaaatggtcctctgagaagcgctttggcctggaaggctgtgaggtgctgatccca
gcgctgaaaacgatcattgacaaatctagcgagagtggcattgataacgtcatcatgggc
atgcctcacagaggtcgtctgaacgtgttggccaatgtgatcaggaaggagctggagcag
atcttctgtcagtttgactccaagttggaagcctctgatgagggcagtggtgatgtaaag
taccatttggggatgtaccacaggaggattaatcgtgtgacaaacaggaatataactctg
tcgctggtggctaacccgtctcacctggaagccgcggatcctgtggtacaaggcaagact
aaggcagagcagttttacctcggtgacaccgaaggcaagaaggtgatgtccgtcctccta
cacggtgatgctgcgtttgcagggcagggcattgtctacgaaaccttccacttgagtgac
ctcccgtcgtacaccacccacggtactgtccacgtggtggtgaataaccagatcggcttc
accacagatccgcgtgtggcccgctcctctccataccccactgacgtggcccgcgtggtc
aacgctcctatcttccacgtgaacggcgatgaccctgaggcagtgatgtacgtgtgtaat
gtagccgcggagtggaggaacaccttccacaaggacgtggtggtcgatctggtttgctat
cggaggaacgggcacaatgagatggacgagcctatgttcacacagccgctgatgtacaag
cagatcaagaagcagaaggcggtgctaaagaagtttgcggagaagctgatggctgagggg
gtggtcaaccagcaggagtttgaggaggaaatggccaagtatgataagatctgtgaggag
gcatacacccgatcgaaggatgagaagatttctcacattaagcactggctggactcgccc
tggcctggtttcttcactctggacggccagccgaaaagcatgagctgtccccccactggc
ttaaatgaagagatgttggaacacattgggaaaattgctagctccgtccctgaggaggat
ttcaccatccacggaggcttgactcgcatcctgaagggccgggcagagatgataaagaac
cgcactgtggattgggccttggctgagtacatggcccttggctccctgcttaaagaaggc
attcacgtccgtctgagtggccaggacgtggagagagggaccttcagccatcgccatcat
gttctccacaaccagaatgtggacaagaaaacctgtatcccaatgaatcatctgtggccc
aaccaggctccatacacagtgtgtaatagctccctgtcagagtacggtgtgctcgggttt
gagttgggctttgctatggctagtcccaatgctttggttctctgggaggctcagtttggg
gatttccacaatactgcacagtgcatcattgaccagttcatctgccctggtcaggccaag
tgggtgcgtcagaacggcatcgtgttgctgctccctcacggcatggagggaatgggaccc
gaacactcgtctgctcggccagagaggttcctgcagatgtgtaatgatgatcctgatgtg
gtcccgaaagtgaccgatgactttgccgtacgccagctgtacgactccaactggattgtg
gtgaactgctccaccccggccaactacttccatgttctccgcaggcagatcctcctgccc
ttcaggaagccgctgatcatcttcacacccaaatccctgctgcgtcaccctgatgccaag
tccagctttgatgccatgttctcaggtacggagttcctgcgagctattgttgaggaggga
ccggcagctcagagcccggagcaggtgaagaggctgctgttctgcactgggaaagtgtac
tatgagctggcaaaggagcgtaagagcagagggatggaggcggaggtcgctatcaccagg
ctggagcagctgtcccccttcccctttgacctggtagatcaggaggcggggaagtacagc
caggctgagctggtgtggtgtcaggaggagcataaaaaccagggttactacgagtacgtc
aagcctcgcatccgcagcaccacacaccgtacccggcccgtctggtactgtgggcgagag
ccagcctcggcccctgccaccggcaataagaacacacacctacacgagctgaagcgcttc
ctggacaccagcttcaacctggaatccttcaaacacctggaaaactaa

DBGET integrated database retrieval system