KEGG   Callorhinchus milii (elephant shark): 103188453Help
Entry
103188453         CDS       T03088                                 

Gene name
wbscr17
Definition
(RefSeq) Williams-Beuren syndrome chromosome region 17
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk00512  Mucin type O-glycan biosynthesis
cmk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    103188453 (wbscr17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cmk01003]
    103188453 (wbscr17)
Enzymes [BR:cmk01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     103188453 (wbscr17)
Glycosyltransferases [BR:cmk01003]
 O-Glycan biosynthesis
  Mucin-type
   103188453 (wbscr17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin
Motif
Other DBs
NCBI-GeneID: 103188453
NCBI-ProteinID: XP_007906654
LinkDB All DBs
Position
Un
AA seq 484 aa AA seqDB search
MSCCVVNIVARLRLNLYFLFLRCKELNYPKELPQISLIFIFVNEALSVILRSVHSAVNHT
PAHLLKEIILVDDNSDDEDLKAPLEEYVHKRYPGLVKVVRNEKREGLIRARVQGWKAAIA
PITGFFDAHVEFSSGWVEPIIARIKNDRKRIILPSIDNIKYNTFEVQRYENCAHGYSWEL
WCMYISPPKEWWDRGDPTAPIRTPAMIGCSFVVNRLFFGEIGLLDPGMDVYGGENIELGI
KVWLCGGSMEVLPCSRVAHIERMKKPYNSDIGFYTKRNALRVAEVWMDDYKSHVYIAWNI
PMDNPGIDIGDISERVLLRKHLNCKSFQWYLDNVYPEMRRFNNTVAYGEVRNNKAKDFCL
DQGPSENHTAILYPCHGMVPQLVRYTREGYLYLGPLGSTVLLPDTRCLVDNRKSQFPQLV
DCEKVKNIHLKSWRFVQNGSILNLETGRCLEVETGRKSDFGLELVLRQCSGQKWTIRNVL
KQAG
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgagttgttgtgttgttaatattgtagcaagactaaggctgaatttatattttctgttc
ctcaggtgcaaagagttgaactacccaaaagaactgccgcagatttccctcattttcatc
tttgtgaatgaagccctgtcagtcatcctccgctctgtgcacagtgcagtgaatcacact
ccagcccatctactcaaggagatcattcttgttgatgataacagtgatgatgaagacctc
aaagcgcctctggaggaatatgttcacaaacggtaccctggtttggtgaaagttgttcgc
aatgagaagcgtgagggactgatccgagcccgagtccagggatggaaagctgccattgcg
ccaatcacaggcttctttgatgcccacgtggaattcagtagtggatgggttgaacctatt
atagccagaattaaaaatgaccggaagcgaattatcctcccatccatcgataacatcaag
tacaatacatttgaggtgcagcgctatgagaactgtgcccatggatacagctgggagttg
tggtgcatgtacatcagcccgcccaaggagtggtgggacagaggagatcccacagctcca
atcaggactccagccatgattggatgctcctttgtggtgaatagattattctttggtgag
atcgggctgctggaccctggaatggatgtttatggtggagagaacatagaattggggatt
aaggtctggctgtgtggtggaagtatggaggtgctgccctgctccagagtggctcatatt
gaacgcatgaaaaagccctacaatagcgatattgggttctacaccaagagaaatgcactg
cgtgtggctgaagtctggatggatgattacaaatctcatgtttacatcgcatggaatatt
cctatggataatccagggattgacattggggatatttctgagagagtactattgcgaaaa
catctcaattgcaaaagtttccagtggtacttggacaatgtgtatccagagatgaggaga
ttcaacaacactgtggcctatggggaggttcgtaacaataaggctaaagatttctgctta
gatcagggcccatcagagaaccacacagccattctgtatccttgtcatgggatggttccc
cagctggtgagatacacgagggaagggtacctgtatctcggcccactgggctccacagtg
ctgctgccagatacgcgctgtctggtggacaacaggaagagtcaatttcctcagctcgtt
gactgcgaaaaagtgaaaaacattcacctgaaatcctggcgctttgtacagaatggatcg
atcctgaacttggaaacgggccgttgtttggaggtggagaccggcagaaaaagtgacttt
gggttggagcttgttttgcggcagtgctctggacaaaaatggacaatcagaaatgtctta
aaacaagcgggatag

DBGET integrated database retrieval system