KEGG   Callorhinchus milii (elephant shark): 103189176
Entry
103189176         CDS       T03088                                 

Gene name
stat3
Definition
(RefSeq) signal transducer and activator of transcription 3
  KO
K04692  signal transducer and activator of transcription 3
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk04068  FoxO signaling pathway
cmk04217  Necroptosis
cmk04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    103189176 (stat3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103189176 (stat3)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103189176 (stat3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cmk03000]
    103189176 (stat3)
Transcription factors [BR:cmk03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    103189176 (stat3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 Syntaxin-6_N
Other DBs
NCBI-GeneID: 103189176
NCBI-ProteinID: XP_007907687
UniProt: V9KE95
LinkDB
Position
Un
AA seq 770 aa
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAAWIETQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRKIKQYLQSRYLERPMEIARIIARCLWEEARLLQVAA
SVSQQAGQSPHHSSVVTEKQQILEHNLQDVRKRVQDLEHKIKVLENLQDDFDFNYKTLKS
QGDVQDLNGNSQAATRQKMAQLEQMLTALDQMRRQIVTDLAALLSTMEFVQKTLTDEELA
DWKRRQQIACIGGPPNICLDRLETWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVHH
RPVLEDRIVELFRTLIKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNYQ
LKIKVAIDKDCGDGSALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGNG
GRASSDASLIVTEELHLITFETEVYHQGLKIDLETSSLPVVVISNICQMPNAWASILWYN
MLTNNPKNVNFFTKPPVATWDQVAEILSWQFSSTTKRGLNMEQLATLAEKLLGPGVNYSG
CHITWAKFCKENMPGKGFSFWVWLDNIIDLVKKFILSLWNDGYIMGFISKERERALLSQK
PPGTFLLRFSESNKEGGITFTWVEKDINGKTQIQSVEPYTKQQLTNMSFADIIISYKIMD
ATNILVSPLVYLFPDIPKEEAFGKYCCSEPQEPIDPNDPDTFAYLKRKFICVTPTNSGNT
SDLFPMSPRTLDSLMHCGTNTESSEQGAAGGLDSITLDMEFGTECAPSPM
NT seq 2313 nt   +upstreamnt  +downstreamnt
atggcgcagtggaaccagttacagcagttggacacgagatacctggagcaattgcaccag
ctttacagtgacagcttccccatggagctcaggcagtttctggcagcttggatagaaact
caagattgggcatatgcagctagtaaggagtctcatgccaccctggtatttcacaatctg
ttgggcgagattgatcagcaatacagcaggtttctgcaggaatccaacgtcctgtatcag
cacaacctaagaaagattaaacagtacctccagagcaggtacctggagcggccgatggaa
attgcacggatcatcgctcgctgcttgtgggaagaagctcgtctccttcaggtggctgcc
tcagtgtcacagcaagccggtcagtcaccacaccatagctctgtggttacagagaaacaa
caaatccttgaacacaatctgcaggatgtacggaagcgagtccaggatcttgaacacaag
ataaaagtgctggagaacctacaggatgactttgattttaattacaagaccctgaaaagc
caaggagatgtgcaggatctgaatggtaattcacaggcagccacaaggcagaagatggca
cagctggagcaaatgttgaccgctttggaccagatgagaaggcaaatcgtcactgacttg
gctgcacttctgtctaccatggagtttgtgcagaaaactctgaccgacgaggaactggct
gattggaaaaggcgacagcagatcgcttgtataggaggcccacccaacatctgccttgac
cgtctcgaaacctggatcacatctttggcagagtctcaactccaaacacgtcagcagatc
aagaagctggaagaactacaacaaaaggtttcttacaaaggcgatcccattgttcaccac
aggccggttctggaggacagaattgttgaattatttcggaccctcattaaaagtgctttt
gttgtagagaggcagccatgcatgccaatgcacccagaccggcccctggtgatcaaaacg
ggtgtgcaattcacaacaaaagtcaggttactggtgaaatttcccgagctaaactatcag
cttaaaatcaaggttgctattgacaaggattgtggcgatgggtcagcattgagagggtca
cggaaatttaacatactgggaaccaatacaaaggtcatgaatatggaggaatccaacaac
ggaagcctgtctgcggagttcaagcatttgacgttgagggaacagagatgtgggaatgga
ggcagagccagcagtgatgcttccctcatcgtgactgaggaactgcacctgatcacattc
gagactgaggtttatcaccaggggctcaagattgatttggagacgtcatcgctccccgtg
gtagtgatctccaacatctgccagatgccaaacgcctgggcctccattctctggtacaac
atgctgaccaacaacccaaagaacgtgaacttcttcaccaaacccccggtagccacttgg
gaccaggtggctgagattctcagctggcagttctcctccaccacgaagagaggcctcaac
atggagcagctggcaacgctggccgagaaactgctgggtcctggagtcaactattctggg
tgtcacatcacgtgggcaaaattctgcaaagagaatatgccgggcaaagggttctcattc
tgggtgtggttggacaacatcatagacctggtgaagaagttcattctgtcactctggaat
gatgggtacatcatgggtttcataagcaaagagagggagcgagccctgctcagtcagaaa
ccaccaggtaccttcctcctgcgattcagtgaaagcaataaagaaggtggaataaccttc
acgtgggtggaaaaggacatcaatgggaaaacccagatccagtccgtggagccctacacc
aaacagcaactgaccaacatgtcctttgctgacatcatcatcagctacaagatcatggac
gccaccaacatcctggtctctccactcgtctacctctttcccgacattcccaaggaagag
gccttcggaaagtattgctgcagtgagccccaggagccgatcgatcccaacgacccagac
accttcgcttacctgaagagaaagttcatttgtgtaacgccaacaaactcgggcaacacg
agcgacctgttcccaatgtctccacgaacactggactcactgatgcactgcggtaccaac
acggagagcagcgagcagggggcagcagggggactcgattccatcactttggacatggag
tttgggacggaatgtgcaccctctcccatgtaa

DBGET integrated database retrieval system