KEGG   Callorhinchus milii (elephant shark): 103189530Help
Entry
103189530         CDS       T03088                                 

Gene name
kmt5c, suv420h2
Definition
(RefSeq) lysine methyltransferase 5C
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    103189530 (kmt5c)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cmk03036]
    103189530 (kmt5c)
Enzymes [BR:cmk01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     103189530 (kmt5c)
Chromosome and associated proteins [BR:cmk03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     103189530 (kmt5c)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 103189530
NCBI-ProteinID: XP_007908150
LinkDB All DBs
Position
Un
AA seq 812 aa AA seqDB search
MESMRVSARDLCEYDDLATSLVLDPYLGFRSHKMNISNIPVVRRHQYLRDIVQKFQSSRD
LESVYRALTLGDWAWQYFLHKTRLEEEIFKSQVFRYLRIFLPESGFQIQPCSRYSSETNG
AKVVSLRKWTESDKIELLVGCLAELSTEEEGLLRPGENDFSVMYSTRKKCAQLWLGPASF
INHDCRPNCKFVSTEGDKACVKVLRDIEAGDEITCYYGNSFFGERNELCECCTCERRGEG
AFKLKTRPEETEACSKYSLRETDIRLSRMKEKGNGRHPPAQLHCHSATGKPFWQTSSYRL
SLSSRRRAGAKSKRQSSRSNIRASPRSAPLLLQCYDPGKRKMPRSNSWSRKWRPDGDRGE
SWSAQGSEEPLPPAHCYPARPHQTKATVSRLPGTLLILEGVVLKDVRVGLYDCINLPRGS
IDSLEPGPREHSGGAVRGKRGQGQGEDMEPEPTDIQREGEGSKPEAFASTSGVVGARIFL
RKPKAPLEGLVASPEERAVSEEQVLGCWRLCGTEGRVGNPSSGSSTGSTMSTKKVAGVLT
LRRRRKRSWWRRRRRTSSKESQSPQVTKPSLRSNYTLTHFVKVDLSKDVVSLSQSSLPPP
PLPPPPPPSVKRQSLCLSGTDAQRDPSPRPLLSPRPQGAICDVRVVLEDIAKICEHASRA
WYVRRCLAARLALGRGGGPSSAESAGAPDWTGSSRALVEGGQDAVVGKVSRQRQTPSGSG
KVAGANEGMMGLGIEPRRKGLRSLASLYRSDTTGLRCDEGTLSQRCLASSAAAAAKQPPA
FTPFAGSKRLRLVVSHGSIDFDVTSSASEDSI
NT seq 2439 nt NT seq  +upstreamnt  +downstreamnt
atggaatccatgcgtgtgtctgccagagatctgtgtgaatacgatgaccttgccacaagc
ctggtcctggatccttacttaggtttccgttcccacaaaatgaatatcagcaatatacct
gttgtcaggagacaccaatacctcagagacatcgtgcaaaagtttcagagctcccgagac
ttggaaagtgtgtacagagcactgaccctgggggattgggcctggcagtacttcctacac
aaaacccgtctcgaagaggagatcttcaaatctcaggtattccgttaccttcgaatcttt
ctgccagaaagcgggtttcagatccagccgtgcagtcgctactcatcagagactaacggt
gctaaggttgtgtccctgaggaagtggacggagagcgacaagatcgagctgctggtgggc
tgcctggcggagctctcgacagaggaggagggtctcctgcggccgggagagaacgacttc
agcgtgatgtactccacccgcaagaagtgtgcccagctttggctggggccagcctccttc
atcaaccacgactgcagaccaaactgcaagtttgtgtcgaccgaaggtgacaaggcgtgc
gtcaaagtgctgcgagatatcgaagccggggacgagatcacctgttactatggcaatagc
ttctttggggaaaggaatgagctgtgtgaatgctgcacgtgtgaaaggcgaggtgaggga
gccttcaaactcaagacccgtcccgaggagaccgaggcctgctccaagtacagcctgcgg
gagaccgacattcgcctgagccgcatgaaggagaaaggcaacggcagacacccacccgca
cagctccattgtcattcagcgactggaaaaccattctggcagacatcgagttacagactg
tccctgagctcgaggagacgggccggagcgaagtcaaagagacagagctcccgtagcaac
atcagagcgtcgcctcgatcggcacctctgctgcttcagtgttacgatcccggcaagcgg
aagatgccgagaagcaacagctggtcgaggaaatggaggccggacggtgacagaggagaa
tcgtggtcagcccagggctcggaggaaccgctccctcctgctcactgctacccggcccgg
ccacaccaaaccaaagccaccgtatcgagattgcccggcactctcctgatcctggagggc
gtggtcctcaaggatgtgcgggtgggcctgtacgattgcatcaatctacccaggggttcg
atcgactcgctagaaccggggcccagagaacacagcggaggggctgtgaggggaaagcgt
gggcaaggccaaggggaagacatggagcctgagccaactgacatccagcgggaaggagaa
gggagcaagccggaagcgtttgcgagcaccagtggagttgtaggcgctaggatctttctg
aggaagcccaaggccccgttggagggcttggtcgcaagcccagaggaacgtgctgtctcc
gaggaacaagtacttggctgctggaggttgtgtgggacagagggtcgagttggaaacccc
tcctctggaagttctaccggttccaccatgagcacgaagaaggtggcgggggtcctcacg
ctgaggaggaggaggaagaggagttggtggaggagaaggagaaggacttccagtaaagag
agccaaagtcctcaagtcacaaagccatcgctgagaagtaattacacattgacccatttt
gtgaaggtcgacctaagcaaggatgttgtctctctgagtcaaagttccctgcctccccct
ccccttcctcctcctcctcctcccagtgttaagaggcagagtttgtgcctgagcgggaca
gacgcccagcgagaccccagcccaaggccgctgctctcgccccgcccgcagggcgcgatc
tgcgacgtgcgggttgtgctagaagacattgcaaagatctgcgagcatgccagccgcgcc
tggtacgtgaggaggtgcttggctgccaggctggccctggggagaggagggggaccgagc
agcgcggaatccgctggggcgcccgactggactgggagcagcagggcgttggtggaaggt
gggcaagacgctgtggtgggcaaagtgtccaggcagaggcaaaccccaagcggaagcggg
aaggtggcaggtgcgaacgagggaatgatgggccttggcatagagccgaggaggaaggga
ctgcggagcttggcctcactctaccgttcggacaccacagggctccggtgcgacgagggg
acgctctcccagcggtgtctggcgtcttcagccgccgcggcagccaagcagccccccgcc
ttcacccccttcgccgggtccaagcgcctgcgtctcgtggtcagccacggctccatagac
ttcgacgtcacctcctccgccagcgaggattccatctga

DBGET integrated database retrieval system