KEGG   Callorhinchus milii (elephant shark): 103190048Help
Entry
103190048         CDS       T03088                                 

Definition
(RefSeq) neutral alpha-glucosidase C-like
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk00052  Galactose metabolism
cmk00500  Starch and sucrose metabolism
cmk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    103190048
   00500 Starch and sucrose metabolism
    103190048
Enzymes [BR:cmk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     103190048
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 103190048
NCBI-ProteinID: XP_007908856
LinkDB All DBs
Position
Un
AA seq 963 aa AA seqDB search
METETENKQGPSAFSEDVGKSKFKTTEDITFYRRQQRLAGGQYRAALGTMQVAEGTASFQ
LHSQKPQPPLLVQLWAAQGPVIRIKITELQPIKARYEVPDVIIAEPVMQRLWVESVTDAC
VMLAVAEGETRLRIVAQPFILEVLRAGHGPGAEANEGPLSVNARGLLYFEHLRLRPEPCS
VESRLEGLEEGMGGAVRAKPHDNLCKAPVPPIQPVQPQQLSSFTHRQSAAQTNSESGWQE
EDEKELWEEKFGEFTDIKTDGPCSVGLDFSLHGYHHVYGIPQHTGHLPLDNTSQGEPYRL
YNLDVFACELHSRMGLYGSVPLLLAHKPHSSLGLLWLNASDTLIHISPQPQEGQQAGAQA
VKPGTDVRWMSESGVIDVYMLLGPTAGEVCAQYARLTGFPMLPPLFALGYHQSRWNYRDE
EEVEKVDAGFDAHHIPYDAIWLDIEHTAGRRYLTWDPLTFPTPQRLQQHLRCQKRKLVVI
SDPHIKVDSEYPLYSQANANGYFVKDNKGCEYQGLCWPGLSAYLDFTNPAVRDWYASKHA
LDQYQGSTDILFVWNDMNEPSVFSGPELTIPRDAVHWGSWQHRHLHNLFSVSQHWATAEG
LLRRSGGAERPFVLTRSFFAGSQRFGAVWTGDNVADWSYLKISIPMLLCLSITGLSLCGA
DVGGFIGNPDWELLVRWYQAAAFQPFFRGHSHIRMERREPWLFGDTATALIRNAIHLRYS
LLPYWYSLFYIAHTTAQPVIRPLWMEFSGETNTFLIDDTYMLGEALLVHPITDRALADVE
LLLPGDGEVWYQLSTNQRFPGAYKLRLPVTIETVPVFQRGGTIIPRKICIGRSTEELWTS
PYALYVALDTQGSARGQLYVDDGHSFAYRNQQQYCHRSFTYLTGSASSSLTARCADTRGD
FYCGCAVEVVVIVGVAQPYSVTANIPDGPTNSVNFTYELLTSFLTISNLALPSGSDWSLS
LHH
NT seq 2892 nt NT seq  +upstreamnt  +downstreamnt
atggagacagagactgagaacaagcaggggcccagcgccttttctgaggatgtcggaaag
agcaaattcaagacaactgaagatatcactttctacaggaggcagcagcggctggctggc
gggcagtatcgggcggcgctgggcaccatgcaggtggccgagggcacagccagcttccag
ctgcacagccaaaagccacagccgccgctcctggtgcagttgtgggcagctcaggggcct
gtgatcaggatcaaaattaccgagctacagccaatcaaagcaagatacgaggtacctgat
gtgattattgcggagcccgtcatgcagaggctgtgggtggagtctgtgactgacgcgtgt
gtgatgctggcggtggcggagggtgagacacggctccggattgtggctcagccgttcata
ctggaggttctgcgggcggggcacgggcctggggcagaggccaacgagggtcctctcagc
gtgaacgcccgcggcctgctctacttcgaacatctccggctcaggcctgagccatgctcg
gtggaatccagactggaggggctcgaggagggaatgggaggagcggtgagagcaaagcca
catgacaacctgtgcaaagcgcctgtaccccccatacagcctgtacagccacaacaactg
agctcttttacacacaggcagagcgcagcacagacaaacagtgagagtggctggcaggag
gaggatgagaaggaattgtgggaggagaaattcggggaatttacagacataaaaaccgat
gggccctgctcggttggattggatttctctcttcacggttaccatcacgtatacgggatt
ccccagcacacgggccacctgcctctggacaacaccagccagggggagccttaccgcctg
tataacctggacgtgtttgcctgtgagctgcacagcaggatggggctgtatggctcggtg
cctctcctcctcgctcacaaacctcacagcagccttggcctgctttggctcaacgcctcc
gacacactgatccacatcagcccccagccccaggaggggcaacaggctggagcgcaggct
gtgaagcctggcactgatgtgcgttggatgtctgagagtggagtcatcgatgtgtacatg
ctgttgggacccacagcgggggaggtgtgtgcgcagtatgccaggctgacaggtttccct
atgttgccgccgctcttcgcgctgggctatcaccagagccggtggaattaccgcgacgag
gaggaggtggagaaggtggacgccggcttcgacgctcaccacattccctacgatgccatc
tggctggacatcgagcacacagcgggcaggcgctacctcacctgggatcccctgaccttc
cccacgccacagcggctacagcaacacctgcggtgccagaagcgcaagctggtggtgatc
agtgaccctcacattaaggtggacagtgagtacccgctgtactctcaggccaacgccaac
ggctacttcgtgaaggacaacaagggttgcgagtaccagggcctgtgctggccaggtctg
tccgcgtatctggatttcacgaaccccgccgtgcgggactggtacgccagcaaacacgcc
ctggaccagtaccagggatccacggatatcctctttgtgtggaatgacatgaacgaaccc
tcggtgttcagcgggccggagctcaccatacccagagacgccgtgcactggggcagctgg
caacaccggcacctccacaatctgttttctgtctctcagcactgggccacggctgagggg
ctgctgcgccggtcgggaggagctgagcgtcccttcgtgctgacaaggtcattctttgcc
ggatcccagaggtttggagcggtgtggacgggcgacaatgtagctgactggagctacctg
aagatctccatccccatgttactgtgtctcagcatcactggcctctctttgtgtggagcg
gatgtgggagggtttattgggaacccggattgggagctgctggtgcgctggtaccaggca
gcggcattccagccctttttccggggacattcccacatccgcatggagcggcgcgagccc
tggctgttcggggatacagcgacggcactgatcaggaatgccatccacctgcgctacagc
ctgctgccgtactggtactcactgttctacattgcccacaccacagcacagcctgtcatc
aggcctctgtggatggagttttccggggagacaaacaccttcctgattgatgacacgtac
atgctgggtgaggctctgcttgttcaccccattactgaccgagcgctggcggacgtggag
ttgctcttacctggtgacggtgaggtttggtaccaactcagcaccaaccagcgcttcccg
ggggcgtacaaactgcgtctgcctgtcaccatagagacagtgccagtgttccagcgagga
ggaacaatcattccaaggaaaatctgtatcgggagatcaaccgaagagctttggacctca
ccctatgccctgtatgtggccctcgacacccagggctcggcgaggggccagctgtatgtt
gatgacggtcactcgtttgcctaccgcaaccagcaacaatattgtcaccgcagcttcacc
tatctcaccggctccgccagcagctcgctcactgcaaggtgtgcggacacgcggggtgac
ttctactgtggctgtgctgtggaggttgtggttattgtgggtgtagcccagccttactct
gtgacggccaacatcccagatggtcccacgaactcggtcaattttacctacgagcttctg
acttccttcttaaccatcagcaacttagcccttccctccggcagcgactggtccctcagc
ctccatcactga

DBGET integrated database retrieval system