KEGG   Callorhinchus milii (elephant shark): 103190252Help
Entry
103190252         CDS       T03088                                 

Gene name
pfkp
Definition
(RefSeq) phosphofructokinase, platelet
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk00010  Glycolysis / Gluconeogenesis
cmk00030  Pentose phosphate pathway
cmk00051  Fructose and mannose metabolism
cmk00052  Galactose metabolism
cmk01100  Metabolic pathways
cmk01200  Carbon metabolism
cmk01230  Biosynthesis of amino acids
cmk03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103190252 (pfkp)
   00030 Pentose phosphate pathway
    103190252 (pfkp)
   00051 Fructose and mannose metabolism
    103190252 (pfkp)
   00052 Galactose metabolism
    103190252 (pfkp)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    103190252 (pfkp)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cmk01009]
    103190252 (pfkp)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cmk03019]
    103190252 (pfkp)
Enzymes [BR:cmk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     103190252 (pfkp)
Protein phosphatases and associated proteins [BR:cmk01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103190252 (pfkp)
Messenger RNA biogenesis [BR:cmk03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     103190252 (pfkp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 103190252
NCBI-ProteinID: XP_007909146
LinkDB All DBs
Position
Un
AA seq 803 aa AA seqDB search
MAQHSPRKLFENLNGAGKAIGVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFVHEGYQGM
VDGGDNIVEATWEKVSSILQMGGTVIGSARCKAFRNREGRLKAALHLVQLGITNLCVIGG
DGSLTGANLFREEWKGLLDELVEKGEIQSEEAMKYSHLNVVGMVGSIDNDFCGTDMTIGT
DSALHRIIEVVDAIVTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFIPESPPEDG
WEDQMCEKLSENRANKKRLNIIIISEGAINRHNVPITSDIIKDLVVSRLGFDTRITILGH
VQRGGTPSAFDRILGSRIGVEAVIALLEASPDTPACVVSLSGNQAIRVPLMECVQMTQEV
QKAMDEKRFDDAVKLRGRSFVNNLNTYKLLAHKTKDVEPPQSNTRRRYCPEKKKKEQSSF
NVAVLNVGAPAAGMNAAVRSAVRIGITEGHRMFAVADGFEGFSKGQIKEIKWGGVGGWTG
QGGSLLGTKRTLPGKNLQAIADQIRTHNISAFMVIGGFEAYLGLLELLAARAKYDEFCIP
MVMVPATVSNNVPGSDFSIGADTALNAITDTCDRIKQSASGTKRRVFIIETMGGYCGYLA
SMGGLAAGADAAYIFEDPIDIRELQANVIHLTEKMKTSIQRGLVLRNENSNDNYTTDFIY
QLYSEEGKGIFDCRKNILGHMQQGGAPSPFDRNFGTKIAAKAVQWLSRTLKENYRRDEGK
IFTNTDDTICLLGMRRRTLLFQPVSQLMSETDLKHRIPKEQWWVNLRALMKILAKYKISY
DVSDAGKLEHVTQRMRDTDNETL
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atggctcaacactctccaaggaaattgttcgaaaacctgaacggggccggtaaagccatc
ggcgtcctgaccagcggaggggatgctcagggtatgaatgctgctgtccgagctgtggta
cgcatgggaatttatgttggagccaaagtctatttcgtccatgagggttaccagggcatg
gtggatggtggagataatattgtagaagcaacatgggagaaagtctccagtatcttgcaa
atgggtggcacagttattgggagcgcacgttgtaaggcattccgtaatcgtgagggccga
ttgaaagctgccctccacctcgtccaacttgggattacaaacctctgcgtgattggtgga
gatggtagtttgactggcgccaatctcttccgtgaagagtggaagggacttttggatgaa
ctcgttgagaaaggtgaaatccaatcagaagaagctatgaagtacagccacttgaatgtt
gtgggcatggttggatctattgataatgacttctgtgggacagatatgacgataggtaca
gactctgccttacatcgcattattgaagttgtcgatgccatcgtgaccacagcccagagt
caccagaggacatttgtgctggaggtaatgggaagacattgtgggtatttagctcttgta
agtgccttggcttgtggtgccgactgggtattcattcctgaatctcctccggaagatggc
tgggaggatcagatgtgtgaaaaactttcagagaaccgtgcaaacaagaaaaggctgaat
atcataattatatcagaaggagcgattaataggcataacgtccctataacttctgacata
ataaaggaccttgtggtttcgcggctgggttttgacacgcgcataactatcttgggtcac
gtccaaagaggaggtacaccatctgcgtttgatcgaatcctgggcagcaggattggagta
gaggccgtgatagctttgttggaggcatcaccagacactccagcttgtgttgtatcactg
tcggggaatcaagctattcgcgttcccttaatggagtgcgtgcagatgactcaggaagtg
cagaaggccatggatgaaaaaagatttgacgacgctgtgaaactccggggcaggagcttc
gtgaacaacctaaacacatataagttgttggcacataagacaaaagatgtagagcctcca
caatcgaacacaaggcggagatattgtccagaaaagaaaaaaaaggagcagagcagcttc
aatgtggcggtgcttaatgtaggtgccccagccgctggaatgaacgcggctgttcgttcc
gcagtgagaatcggcatcactgaaggtcacagaatgtttgccgtggctgatgggtttgaa
ggattttccaaggggcagatcaaagagattaaatggggaggtgtcggaggctggactggc
caaggtggatccttgttgggcactaagcggactctccctgggaagaacctgcaggccatc
gctgatcaaatacgtacacataatatcagtgcattcatggttattggtggctttgaggca
tacctgggacttttggaactgttagctgcgcgtgccaagtatgacgagttctgtatcccc
atggttatggttcctgccactgtctccaacaatgtgcctggttcagacttcagcattggt
gcagatacagccctgaacgctattactgatacatgtgaccgtatcaaacagtcagcaagt
ggaacaaagcgccgtgttttcattattgagaccatgggcggatactgtgggtacctggcg
agtatgggaggactcgctgctggggcagatgctgcttacatcttcgaggatccaattgac
attcgtgaattgcaggccaatgtgatacacttgacagagaagatgaaaacctctatccag
cggggtctagtgctcagaaatgaaaattccaatgataactatacaactgacttcatctat
cagctgtattctgaagaagggaagggtatatttgactgccggaagaacattctgggacat
atgcaacagggcggtgcaccatctccatttgatagaaactttggaaccaaaattgctgcg
aaagccgtccaatggctctcaaggactctaaaagagaactacagaagagatgaaggcaaa
atatttacgaataccgatgatacaatttgcctgcttggcatgcgtagacgcaccctcctc
ttccagcctgtgtcacagctgatgtctgagacagatttaaaacatcgaattcccaaggag
cagtggtgggtgaacctccgggcactgatgaagattctggccaaatacaagatcagttac
gatgtgtccgatgccggaaagcttgagcacgttacccaacgtatgcgtgatactgataat
gaaaccttataa

DBGET integrated database retrieval system