KEGG   Callorhinchus milii (elephant shark): 103190258
Entry
103190258         CDS       T03088                                 

Gene name
tgfa
Definition
(RefSeq) transforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk04010  MAPK signaling pathway
cmk04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103190258 (tgfa)
   04012 ErbB signaling pathway
    103190258 (tgfa)
SSDB
Motif
Pfam: TMEM154 EGF Insulin_TMD ECSCR Orthoreo_P10 Collectrin DAG1 GAF Psg1 Mid2
Other DBs
NCBI-GeneID: 103190258
NCBI-ProteinID: XP_007909167
UniProt: V9LEP5
LinkDB
Position
Un
AA seq 156 aa
MFTLCVDVALVISGVLVVCNAVENTTSTLTGAPVAAAVRSHFSDCPDSHRQFCFHGSCRF
LVQEETPACICHSGFIGIRCEHADLLAVVATNQKQQTIATLVVVSIVVSVLLIAVCVLIH
CCRKRRKCEFCQTLFSRHEISLLKSGAGGSHSDTGV
NT seq 471 nt   +upstreamnt  +downstreamnt
atgttcactttgtgtgtggacgtcgctcttgttatatcaggtgtcctagttgtttgcaat
gctgtggagaacacaacctcaacattgacaggtgcccctgtagccgccgctgtgcgctca
cacttttccgactgccctgacagccaccggcagttctgcttccacggatcgtgtcgcttt
ctggtgcaggaggagacgccagcttgcatatgccactcggggtttatcgggattcggtgt
gaacacgcggacctcctggcggtggtcgcaactaatcagaagcagcaaacaatcgcaact
ttagttgtggtgtctatagtcgtgtcagtccttctgatcgcagtttgcgtcttaatacac
tgctgtcgaaagcgcaggaaatgcgaattctgccaaacactgttctctcgccacgaaatc
agtctcctgaagagcggagcaggaggcagtcacagtgacacaggagtgtga

DBGET integrated database retrieval system