KEGG   Callorhinchus milii (elephant shark): 103190420
Entry
103190420         CDS       T03088                                 

Definition
(RefSeq) erythropoietin-like
  KO
K05437  erythropoietin
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103190420
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cmk04052]
    103190420
Cytokines and growth factors [BR:cmk04052]
 Cytokines
  CSF and other factors
   103190420
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 103190420
NCBI-ProteinID: XP_007909380
LinkDB
Position
Un
AA seq 134 aa
MQKQCNDTFSLPGNVTLPKTNVNYREWAEKDMGRKAEEIQTGLKLLTNAIEMAQNVTTNS
NRLHVIEKSYSNIRSVTQMVKSLTMPDLAHQEVQLLETFHTRTLRAIFHVYSNFLQGKVR
LLFFDAKPCRLARS
NT seq 405 nt   +upstreamnt  +downstreamnt
atgcagaaacaatgcaacgacacgttcagtctcccaggaaatgtcacgcttccaaaaacc
aacgttaactacagagaatgggcagaaaaggacatgggaaggaaggcagaagagattcag
actggcctcaaactactaacaaacgcaatcgagatggcccagaatgtgactacaaacagc
aacagattacatgtgatagagaagagctacagtaatattcgcagtgtaacacagatggtg
aaaagtttaactatgccggacttggctcatcaggaagttcagctactggaaaccttccac
acaagaacgctgagagccattttccacgtgtattcgaacttcctacaagggaaagtcaga
ctgttattctttgacgcaaagccctgcagattggccagaagctga

DBGET integrated database retrieval system