KEGG   Callorhinchus milii (elephant shark): 103190968Help
Entry
103190968         CDS       T03088                                 

Gene name
hemopexin
Definition
(RefSeq) hemopexin-like
  KO
K18977  hemopexin
Organism
cmk  Callorhinchus milii (elephant shark)
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cmk02000]
    103190968 (hemopexin)
   00536 Glycosaminoglycan binding proteins [BR:cmk00536]
    103190968 (hemopexin)
Transporters [BR:cmk02000]
 Other transporters
  Pores ion channels [TC:1]
   103190968 (hemopexin)
Glycosaminoglycan binding proteins [BR:cmk00536]
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   103190968 (hemopexin)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hemopexin
Motif
Other DBs
NCBI-GeneID: 103190968
NCBI-ProteinID: XP_007910088
UniProt: V9KS17
LinkDB All DBs
Position
Un
AA seq 482 aa AA seqDB search
MLSQAVCSPILCQRVLTTQSSRGVYNSDCQTPDQHSLTTTRTMKLLSLLCLSSIFTLGLA
FRIHGKKHSAEVDVRSQHPNLTGLPDRCNDEGFDAITLDHQGIIYYLRGDYVWAGYRSPA
TFLNQTWPELPGHIDAAFRIHHPSNPQLHNNTFFFKDGKVWQFHGQTLKGQFLMGERFPG
IPVGLDAAVECPAGECPQDSVLFFKEGSVYMLDLLTNIVKEKHWPALGRCTAAMRWLEKY
YCFQGVRFTHFNPISGSVPTGYPKEARNYFMRCAGFGHHHGSNSSFHATYQKCSNSSFDG
FSVDAIGRMYAFRGNWYYRLDTKQDGWHPWRINSSWPSLHSKINGVFTWDKKIYFIQGSQ
LFVYRTEAQYVLIEGYPKPVQDELGINGSQVDATFMCQQSSILYVVMGNRVGTVDLVQTP
RVLSDGFLIRHPHVDAAMCTNDRIFLFVGTKYYLYTSVEQLATSKHLPEEHNIAIELMGC
SH
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgctgagtcaggctgtttgttcccctatcctgtgccagagggttcttaccacacagagc
tctcggggagtatataactctgactgtcagacccctgaccagcactcgctgaccaccaca
cgcaccatgaagttgctctccctgctctgtctctccagtattttcactctggggctcgcc
tttcggattcatggcaaaaaacatagtgctgaggtggatgtgagaagccagcaccccaac
cttaccgggctcccagaccgatgcaatgatgaaggatttgatgcaatcacgttggatcat
cagggaataatttattatttgcgaggtgactacgtgtgggcaggttaccgaagtcctgca
acctttttgaaccagacctggcctgagctccccggccacatagatgctgcctttcgcata
catcaccccagcaaccctcagctccacaacaacaccttcttcttcaaggatgggaaggtg
tggcagtttcatggacaaacgctgaagggacagttcctgatgggagagagattcccagga
atccctgtgggattggatgctgcggtggagtgtccggccggagaatgtccgcaggattcc
gtcctcttcttcaaagagggctctgtgtacatgctggacctgctgacgaacattgtgaag
gagaagcattggccagcgctgggtcgctgtacggccgccatgcgatggctggagaaatat
tactgtttccagggagttcgcttcactcacttcaatcccatctccgggagtgttcccacc
ggataccccaaggaagcccgcaactacttcatgagatgtgcagggttcggacaccatcat
ggcagtaattccagctttcacgcaacgtaccaaaaatgcagcaacagcagctttgacggg
ttttctgttgacgctatcgggagaatgtatgcattcagaggcaactggtactaccgcctg
gacacaaagcaggatggatggcatccatggcgaattaactcctcctggccatccctgcac
agcaagataaatggagtcttcacctgggacaagaaaatctacttcatacagggatcccag
ctcttcgtatacagaactgaggcccaatatgtcctgatagagggatatcccaaacccgtt
caggatgagctgggaattaacggaagccaagtagatgcaacatttatgtgccaacaaagt
tcaatcctctatgttgtcatgggtaacagagtggggacggtggacctggtgcagacaccc
agggtgttgagtgatggcttcctgattagacaccctcacgttgacgccgccatgtgcacg
aatgacagaatcttcctgtttgttgggaccaagtattacctgtacacctcggtggagcag
ctggctacatccaaacaccttccagaggagcacaacattgccattgaattgatggggtgc
tcccattga

DBGET integrated database retrieval system