KEGG   Callorhinchus milii (elephant shark): 103191442
Entry
103191442         CDS       T03088                                 

Gene name
epo
Definition
(RefSeq) erythropoietin
  KO
K05437  erythropoietin
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103191442 (epo)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cmk04052]
    103191442 (epo)
Cytokines and growth factors [BR:cmk04052]
 Cytokines
  CSF and other factors
   103191442 (epo)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 103191442
NCBI-ProteinID: XP_007910620
UniProt: V9LEW9
LinkDB
Position
Un
AA seq 177 aa
MGNRLTHGQSRNVTAKDYEDSDMGIPGLFALIVMLLGYIKPTKLSPPHSICDSRILDKYI
KEAKEAENAMKQCNDTFSLPGNVTLPKTNVNYREWAEKDMGRKAEEIQTGLKLLTNAIEM
AQNVTTNSNRLHVIEKSYSNIRSVTQMVKSLTMPDLAHQEVQLLETFHTRTLRAIFH
NT seq 532 nt   +upstreamnt  +downstreamnt
atgggaaatagattaacacatggacaatcaagaaatgtgactgcaaaagattatgaagat
tcggatatggggatacccggcctttttgcattaatagtgatgttactgggttacataaaa
ccaacaaagctgtctccacctcattctatctgtgacagcaggatattggacaagtacatc
aaagaggcgaaggaggcagaaaatgcaatgaaacaatgcaacgacacgttcagtctccca
ggaaatgtcacgcttccaaaaaccaacgttaactacagagaatgggcagaaaaggacatg
ggaaggaaggcagaagagattcagactggcctcaaactactaacaaacgcaatcgagatg
gcccagaatgtgactacaaacagcaacagattacatgtgatagagaagagctacagtaat
attcgcagtgtaacacagatggtgaaaagtttaactatgccggacttggctcatcaggaa
gttcagctactggaaaccttccacacaagaacactgagagccattttccacg

DBGET integrated database retrieval system