KEGG   Carnobacterium maltaromaticum: BN424_345Help
Entry
BN424_345         CDS       T02342                                 

Gene name
gadB
Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
cml  Carnobacterium maltaromaticum
Pathway
cml00250  Alanine, aspartate and glutamate metabolism
cml00410  beta-Alanine metabolism
cml00430  Taurine and hypotaurine metabolism
cml00650  Butanoate metabolism
cml01100  Metabolic pathways
cml01110  Biosynthesis of secondary metabolites
cml01120  Microbial metabolism in diverse environments
cml02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:cml00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BN424_345 (gadB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BN424_345 (gadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BN424_345 (gadB)
   00430 Taurine and hypotaurine metabolism
    BN424_345 (gadB)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BN424_345 (gadB)
Enzymes [BR:cml01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     BN424_345 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: CCO09825
UniProt: K8E1X5
LinkDB All DBs
Position
390957..392360
Genome map
AA seq 467 aa AA seqDB search
MFNRKIEKEIMEETNCPIFGSLEAGQILPNYKIGKESVDPRVAYQLVKDQLVDEGNARQN
LATFCQTYMEPEAEQLMAETFEKNAIDKSEYPQTAKLESSCVNMIADLWNASEDEKFMGT
STVGSSEGCMLGGMAMKFRWRNLAEKRGLDIQAQKPNLVISSGFQVCWEKFCVYWDIEMR
EVPMDEEHLSINLDKVMDYVDEYTIGIVGILGITYTGKFDDIAALDTLVESYNQINEHQL
VIHVDAASGGMFVPFVNPELAWDFRLKNVVSINTSGHKYGLVYPGVGWILWRDEEYLPKE
LVFDVSYLGGHMPTMAINFSRSASQIIGQYYNFLRFGFEGYRKIHTRTKEAALYLAKVVE
ETGLFEIYNDGGNLPIVCYKLKEKASVEWNLYDLADRLQMKGWQVPAYPLPEEMNNVIIQ
RYVCRADFGQSMAEEFASDLNESIHDLNNAHILFHKEEANKTQGFTH
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgtttaacagaaaaatagaaaaagaaattatggaagaaacgaattgtccaatttttgga
tcattagaagcaggtcaaattttaccaaattataaaataggtaaagaatcagtagatcca
agagttgcctatcaattagtgaaagatcagctagtagatgaaggaaatgctaggcaaaat
ttggcaacattttgtcaaacatatatggaaccagaagctgagcaattgatggctgagaca
tttgaaaaaaatgcgattgataagtctgagtatccacaaacagcaaaattagaaagctct
tgtgtcaatatgattgctgatttatggaatgcatctgaagatgaaaaattcatgggaact
tctactgttggatctagtgaaggctgtatgttaggtggaatggctatgaaattcagatgg
cgtaatcttgctgaaaaacgtggcttagatatacaagcccaaaaacctaatcttgttatc
tcatcaggatttcaagtttgttgggaaaaattctgtgtgtactgggatattgaaatgcgt
gaagttccaatggatgaagagcatttaagtattaacttagataaggttatggattatgtc
gatgaatatacaatcggaattgtaggtattctaggtattacttacactggtaaatttgat
gacattgcagctctagatacattagtagaaagctataaccaaattaatgagcatcagcta
gttattcatgtggatgcggctagtggtggaatgtttgttccttttgttaatcctgaatta
gcttgggattttcgattgaaaaatgttgtatctattaatacatctggtcataaatatgga
ttggtttatccaggagtaggttggattttgtggcgggatgaagaatatttaccaaaagaa
ttagtctttgacgttagttatttaggcggtcatatgccaacgatggctattaatttttcc
cgtagtgcaagccaaattatcggacagtattataatttcttgcgatttggttttgaaggg
tatcgaaaaattcatactcgaacgaaagaagcagcactttatctagcaaaagttgtagaa
gaaacgggactttttgaaatttataacgacggtgggaatttaccgattgtgtgttacaaa
ttaaaagaaaaagcatcagtcgaatggaatctgtacgacttagcagatcgtttacaaatg
aaaggttggcaagttcctgcatacccgctaccagaagaaatgaataatgtgattattcag
cgttatgtatgtcgtgctgattttggacaaagtatggctgaagagtttgctagtgattta
aatgaaagtattcacgatttaaataatgctcatattcttttccataaagaagaagcaaat
aaaacacaagggtttacacattaa

DBGET integrated database retrieval system