KEGG   Chlamydia muridarum Nigg3 clone G0.1.1: NC80_01870Help
Entry
NC80_01870        CDS       T03404                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
cmm  Chlamydia muridarum Nigg3 clone G0.1.1
Pathway
cmm00061  Fatty acid biosynthesis
cmm00780  Biotin metabolism
cmm01100  Metabolic pathways
cmm01130  Biosynthesis of antibiotics
cmm01212  Fatty acid metabolism
Module
cmm_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:cmm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    NC80_01870
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    NC80_01870
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    NC80_01870
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cmm01004]
    NC80_01870
Enzymes [BR:cmm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     NC80_01870
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     NC80_01870
Lipid biosynthesis proteins [BR:cmm01004]
 Fatty acid synthase
  Component type
   NC80_01870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: AIT90572
UniProt: A0A097KEQ4
LinkDB All DBs
Position
complement(440383..441279)
Genome map
AA seq 298 aa AA seqDB search
MLKIDLTGKIAFIAGIGDDNGYGWGIAKMLAEAGATILVGTWVPIYKIFSQSWELGKLNE
SRKLSNGELLTLAKIYPMDASFDTPEDVPQDILENKRYKDLSGYTVSEVVEQVKKDFGHI
DILVHSLANSPEIAKPLLDTSRKGYLAALSTSSYSFISLLSHFGPIMNEGASTISLTYLA
SMRAVPGYGGGMSAAKAALESDTKVLAWEAGRRWGIRVNTISAGPLASRAGKAIGFIERM
VDYYLDWAPLPSPMEAEQVGAAAAFLVSPLANAITGETLYVDHGANIMGIGPEMLPKD
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaaattgatttaacaggaaaaattgcgttcatagcaggtataggtgacgacaat
ggatatggctggggcattgctaaaatgttagcggaagccggcgccaccattcttgtgggc
acttgggttcctatttacaaaattttctcccaatcctgggaactaggaaaacttaatgaa
tctcgcaaattatcaaatggagagctgcttactcttgctaaaatctatccaatggatgcc
agtttcgacaccccagaagatgtccctcaagatatcttagaaaataaacgctacaaagac
ctttctggctatactgtatccgaagtggtagagcaggtaaaaaaagatttcgggcatatc
gatatccttgtccattctcttgcgaatagccccgaaattgccaaacctttacttgatact
tcacgcaaggggtatcttgcagctctaagcacatctagctattcctttattagccttctt
tcccatttcggacccattatgaatgaaggcgccagcacaatctctttgacatatctcgct
tctatgcgtgctgttcctggatatggtggcgggatgagcgctgcaaaagctgctttagag
agtgacacaaaggtattggcttgggaagctggtagacgttggggaattcgcgtaaatacc
atttcggcaggacctttggccagccgagctggaaaagcgattggatttattgagcggatg
gtggattactatcttgattgggcgccactaccatctccaatggaagctgaacaagtgggc
gccgcggcggcattccttgtttctcctttagctaatgccattacaggagaaactttatat
gtagaccacggagccaacattatgggcataggtccagaaatgcttcctaaggattaa

DBGET integrated database retrieval system