KEGG   Cucumis melo (muskmelon): 103487179Help
Entry
103487179         CDS       T03195                                 

Definition
(RefSeq) DNA repair protein UVH3
  KO
K10846  DNA excision repair protein ERCC-5
Organism
cmo  Cucumis melo (muskmelon)
Pathway
cmo03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:cmo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    103487179
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cmo03400]
    103487179
DNA repair and recombination proteins [BR:cmo03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     103487179
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: XPG_N XPG_I UBM
Motif
Other DBs
NCBI-GeneID: 103487179
NCBI-ProteinID: XP_016899699
UniProt: A0A1S4DUP2
LinkDB All DBs
Position
Un
AA seq 1561 aa AA seqDB search
MGVQGLWELLAPVGRRVSVETLAGKKLAIDASIWMVQFIKAMRDDRGEMVRNAHLLGFFR
RICKLLFLRTKPVFVFDGATPALKRRTLIARRRQRENAQAKVRKTAEKLLLNHLKVMRLK
ELAEDLQNQKQQRKQKLPKKSTLPSPKEKFDGTSTSERCKSVPNRGSHENLDGMLGASIM
AEEKGIFSSSASSVAGATLDKEDGDEQSVVNQKYNKDSKGKELLSDETHVVGSDSERMDL
ASRRHQQNVDEMLAASIAAEEARSLNGKASASAVTNLDGEDTDDEDEELILPEMHGVVDP
SVLAALPPSVQLDLLVQMRERLMAENRQKYQRVKKDPAKFSELQIQAYLKTVAFRQDIDQ
VQKAAAGRGVGGVQTSRVASEANREFIFSSSFTGDKQALASARAEKNGDKDVQAPIVQQP
LSSLKSTKIPSTSNPLARSTPDKSEVFEENIETFLDERGRVRVSRVRAMGIHMTRDLERN
LDLMKEIEKTTSAKKATNPDLMQNIEICNPESFSFQSQDLDTSDEGVGGSINKLDERGTE
FMLNEETAIEIMLEDEGGKSFDGDDDLFTNLAAENPIGMGSFDISTQKLSLDNTTDSAWV
EALEEKFILQKNVGVDDHCFKEGIVSDESEVDWEDGVCDHVNPVPFEADSAKSVSKGSLE
EEADLQEAIRRSLEDKGYTKTGPLSSDHQQPQPVIVGKRAEHNTSALKENMIGLGKLDSD
DGMSSLNFNDSSGIKGTTESLSQEKQCSEPVVLLDTKTHTLSEQLDASYNDTTFSPKELN
ENNDALEPLSEDASSAVQVGDMINNTLVNSPCHMVEMEGFYTPGNGSSPKSFACENHLKQ
NLPVDKHSHDLLLDEKDAKIPIVEKTSSAEITEDELMNRISVLEQERLNLGDEQKRLERN
AESVNSEMFAECQELLQMFGLPYIIAPMEAEAQCAYMELANLVDGVVTDDSDVFLFGAKS
VYKNIFDDRKYVETYFMKDIENELGLNRDKLIRMALLLGSDYTEGVSGIGIVNAVEVMNA
FLEEDGLHKFKEWIESPDPSILGPLGAKTGLNARKRGSKASENETTCSNSSGPASEENIS
KDLKENMTVKQSFMDKHRNVSKNWHIPSEFPSEAVISAYICPQVDKSAEPFSWGKPDHFV
LRRLCWEKFGWENSKADELLLPVLKEYSKHETQLRLEAFYTFNERFAKIRSKRIKKAVKS
ITGSRSAVLMDDAVRDASVNNQKELSVEPKENISEKCSSEIQGASSNKEDIENRLQKPSR
KRQLDGEQSQFGKGKKLTKKEKGKRSVSEGSHSKRGRGRGRGRGRLASRGKTPITDLVET
SSSDDESEFDNQKFDSENLPEPQERRRSSRIRKSASYAIDDSNQLSDHSADRFSNDKAEE
DMVVQGQYAYPETIISQYENTESSSRTLKQSLQNDYLETGGGFCLVEDETSRQEMCQNKD
PAMEANNSEDYLTIGGGFCLDDNDECVDPVAHPNQATILEVQKDDLIPDRSTFSPKKHIV
EEDTDTHIESLHNLGNSSYVSNRNSSQVGENVEEEPKDHCVRAFGGGLSAMPNLRRKRRK
Y
NT seq 4686 nt NT seq  +upstreamnt  +downstreamnt
atgggagttcagggtctttgggagctcttagcccccgtcggccgccgtgtctccgtcgaa
accctagccggaaaaaagctcgccatcgatgcgagcatttggatggtacaattcataaag
gctatgcgcgatgataggggagaaatggtccgaaacgctcatttactcggtttttttcga
cggatttgtaaactgttattcttgcggaccaagcctgtttttgtcttcgatggtgcaacc
ccggctctcaagcgccgtactctcattgctcgccgtaggcagcgtgagaacgcccaggct
aaagttcgtaagaccgccgagaaattgcttcttaatcatctcaaggtaatgaggttaaaa
gaacttgctgaggatctacagaaccagaaacagcagaggaagcaaaaactacccaaaaag
agtaccttgccaagccctaaggaaaaatttgatggtacttcgacttcggaaaggtgcaaa
agtgtcccaaataggggcagtcatgaaaatctagatggaatgttgggagcatcaattatg
gccgaggagaaagggattttctcaagtagtgcttcctctgttgctggtgctactcttgat
aaagaggacggtgatgaacagtcagttgtgaaccagaagtacaacaaggactcaaagggc
aaggagcttttgtcagatgaaacacatgtagtggggagtgattcagaaaggatggacttg
gcctcaagaaggcatcagcaaaatgtagatgagatgttggcggcatccattgcagcagaa
gaagcaagaagtttgaatggaaaggcatcagcatctgctgttacaaatctggatggtgaa
gatacggatgatgaagatgaggagttgattttgcccgaaatgcatggggtagttgatcct
tctgtgttggccgctttgccaccttcagttcaacttgatcttcttgttcagatgagagag
agattaatggcagaaaacagacagaaatatcaaagggtcaagaaggaccctgcaaagttt
tctgagctacagatacaggcgtatcttaaaactgttgcttttcgacaagatattgatcaa
gtgcagaaggctgctgctgggagaggggttggtggtgtacaaacatcaagagttgcctcg
gaagcaaacagggaatttattttttcatcatcttttacgggtgataaacaggctcttgcg
tctgctagagctgagaagaatggagacaaagatgtacaagcaccaatagttcagcaacct
ttaagttccctgaaaagtaccaaaattcctagtacatccaatcctctggctcgatcaact
cctgataagtcagaagtttttgaggaaaacattgaaacatttttggatgagaggggacgt
gtgcgagttagtagggtcagggcaatggggatacatatgacacgagatttagaaaggaac
ttggatttgatgaaagagattgagaagactaccagtgcaaagaaagctacaaatcccgac
cttatgcaaaatattgaaatatgtaatccagaaagcttttcttttcaaagccaagatcta
gatacttcagatgaaggtgttggtggatccattaataagttagatgagagaggtacagag
ttcatgctgaatgaagaaactgctatagaaattatgctggaagatgagggtgggaagtct
tttgatggcgatgacgatctatttactaatttagctgcagaaaatcccattggaatgggt
tcttttgatatctcgacccaaaaactctctcttgataatacgacagattctgcttgggtg
gaagcacttgaagaaaaatttatactccaaaaaaatgttggagtggatgatcactgcttc
aaggaaggaatcgttagtgatgagagtgaagtagattgggaggatggagtttgtgatcat
gtaaacccagttccttttgaagctgattcggcaaagtcagtttctaaaggttctttggag
gaagaagctgacttgcaggaggcaataagaagaagtttggaggacaaaggatatacaaaa
actgggcctttatcttctgatcatcagcaaccacaaccggtgattgttggaaaaagggcc
gaacataatacaagtgccctaaaagagaatatgattggacttggtaagctagatagtgat
gatggaatgagttctttaaattttaatgattcttccgggataaagggaacgactgagagt
ttatctcaagaaaagcaatgctcagaaccagttgtgttgttagatacaaaaacacacaca
ctctccgaacagttggatgcttcttataatgatactacattttctcctaaagagttaaat
gaaaataatgatgctcttgagcccttatctgaagacgcatctagtgcagtccaagttggg
gatatgataaataatactttggttaattctccttgtcatatggttgagatggaaggcttt
tacactcctgggaatggttcatcccccaaatcttttgcctgtgaaaaccatttgaagcaa
aatcttcctgttgacaagcatagtcacgatcttttgttggacgagaaggatgcaaaaata
cccattgttgaaaaaacaagtagcgcagagattacagaggatgaattgatgaatagaatt
tcagttctggagcaagaacgtctgaatcttggagatgagcagaaaagacttgagcgtaat
gctgaatctgtcaacagtgaaatgtttgcagaatgtcaggaattactgcaaatgtttggc
ttaccatatattattgctcctatggaagcggaagctcagtgtgcttatatggaacttgca
aatcttgttgatggggtggtgactgatgactctgacgtcttcctatttggggcaaaaagt
gtttacaagaatatatttgatgaccgcaaatatgtcgagacatattttatgaaggacatt
gaaaacgagcttggtctgaatcgggacaagttaattcgaatggcactactacttggaagt
gattatacagaaggggttagtggcattggcattgttaatgccgttgaggttatgaatgca
tttctggaggaagatgggctccataaattcaaagaatggattgaatcaccagatccaagc
atcttagggccgcttggtgcaaaaacagggttaaatgcacgcaaaagagggtcaaaagca
agtgagaatgaaacgacttgctcaaatagtagtggtcctgcatctgaagagaacatatct
aaagatctcaaggaaaacatgactgttaaacagagtttcatggataagcatagaaatgtt
agcaagaactggcacataccttctgaatttcctagtgaagcagtcatttctgcttacatc
tgcccacaagtggacaagtcagcagaacctttctcctgggggaagccagaccattttgtc
cttcgcagattatgctgggaaaagtttgggtgggagaactcgaaggcagatgaattgctt
ttgccagttctgaaagagtacagcaaacatgagactcaacttcgattggaggcgttttac
actttcaatgaacggtttgctaaaatccgcagcaagagaataaaaaaagctgttaaaagt
attactgggagcaggtctgccgtgttgatggatgatgctgtgcgggatgcttctgtaaat
aatcaaaaagaactttctgttgagcctaaggagaacatatccgagaaatgctcatcagaa
atacaaggtgcatcttcgaataaagaggacatagaaaatagactccaaaaaccttccagg
aaaaggcagctagatggagagcaatctcaatttggtaagggtaaaaaactaacaaagaaa
gaaaaaggaaagagaagtgtaagtgagggatcacattccaagagagggagggggagaggg
agagggagaggccggttggcatcgagaggaaagactcctattactgacttggttgaaacc
agctctagtgatgatgaaagtgaatttgacaatcagaaatttgattcggagaatttgccg
gagcctcaagaaaggagacgatcatcacgaatccgaaaatctgcaagttatgcaattgat
gattcaaaccaactatcagatcacagtgcggatagattctctaatgataaagccgaagaa
gatatggtggttcagggtcagtacgcttatcctgaaactatcataagccaatatgagaat
acagaatccagttccagaactctcaagcaatctctacagaatgattatctcgaaactgga
ggtggtttctgtctggtagaagatgaaacaagccggcaagaaatgtgccaaaacaaagat
ccagctatggaggctaacaatagtgaagactacctgacaataggaggtgggttttgctta
gatgacaatgatgaatgtgttgacccggttgcacaccctaaccaagcaaccatattagaa
gtccagaaagatgatcttattcctgatcggtcaaccttctctcctaaaaaacatatagtt
gaggaagatacagacacgcatatagagtctctgcacaatttgggcaactcgagttatgtg
agtaatcgaaactcttcccaggtaggtgagaatgtggaagaggaacccaaggatcattgt
gtaagggcatttggaggaggtttaagtgccatgccaaatttgagaagaaagagaaggaag
tattga

DBGET integrated database retrieval system