KEGG   Cucumis melo (muskmelon): 103487257Help
Entry
103487257         CDS       T03195                                 

Definition
(RefSeq) probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC
  KO
K09667  protein O-GlcNAc transferase [EC:2.4.1.255]
Organism
cmo  Cucumis melo (muskmelon)
Pathway
cmo00514  Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:cmo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    103487257
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cmo01003]
    103487257
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cmo03036]
    103487257
Enzymes [BR:cmo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.255  protein O-GlcNAc transferase
     103487257
Glycosyltransferases [BR:cmo01003]
 O-Glycan biosynthesis
  O-linked GlcNAc type
   103487257
Chromosome and associated proteins [BR:cmo03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    NSL complex
     103487257
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_41 TPR_1 TPR_11 TPR_2 TPR_8 TPR_17 TPR_7 TPR_12 TPR_16 TPR_14 TPR_19 TPR_10 TPR_9 TPR_6 NARP1 TPR_MalT BTAD TPR_15 FAT EST1_DNA_bind TPR_21 ANAPC3 SNAP GBP_C
Motif
Other DBs
NCBI-GeneID: 103487257
NCBI-ProteinID: XP_008443744
UniProt: A0A1S3B897
LinkDB All DBs
Position
Un
AA seq 985 aa AA seqDB search
MMSVQGEVRHQQLLPGTGAVVGVSRAAFGSDRNSESFVGKGEPPSLSLVTFESPDSHEVD
EETYLALAHQKYKNGDYKQALEHSTLVYERNSLRTDNLLLMGAIYYQLSDFDMCIAKNEE
ALRIEPRFAECYGNMANAWKEKGNIDLAIRYYLHAIELRPNFCDAWSNLASAYMRKGRLG
EAAQCCRQALALNPLLVDAHSNLGNLMKAQGMVQEAYSCYLEALRIQPTFAIAWSNLAGL
FMESGDLNRALQYYKEAVKLKPQFPDAYLNLGNVYKALGMPQEAIVCYQRAIQMRPNYAI
AYGNLASTYYEQSQLDMAILHYKQAITCDPRFLEAYNNLGNALKEFGRVEEAIQCYNQCL
ALQPSHPQALTNLGNIYMEWNMVPAAASYYKATLRVTTGLSAPFNNLAIIYKQQGNYADA
ISCYNEVLRIDPLAADGLVNRGNTYKEIGRVSEAIQDYIRAINIRPTMAEAHANLASAYK
DSGLVEAAIKSYKQALHLRPEFPEATCNLLHTLQCVCNWEDRDKMFAEVEGIIKRQINMS
VLPSVQPFHAIAYPIDPLLALEISRSYASHCLKIASRFSLPSFNHPSPVPIKRNGGFERL
RIGYVSSDFGNHPLSHLMGSVFGMHNREHVEVFCYALSPNDNTEWRQRIQFEAEHFVDVS
AMTSDVIAKMINEDKIQILINLNGYTKGARNEIFAMQPAPIQVSYMGFPGTTGATYIDYL
VTDEFVSPLRYAHIYSEKIVHLPHCYFVNDYKQKNLDALDSNCQHKRSDYGLPEGKFIFA
CFNQLYKMDPEIFNTWCNILKRVPNSALWLLRFPAAGEMRLRAYAVAQGVQPEQIIFTDV
AMKNEHIRRSALADLFLDTPLCNAHTTGTDILWAGLPMITLPLEKMATRVAGSLCLATGL
GDEMIVSSMKEYEEKAVTLALNRPKLQALTNKLKAVRMTCPLFDTARWVRNLERSYFKMW
NLHCSGQRPQHFKVTENNLEYPFDR
NT seq 2958 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcggtacaaggcgaggttcgccatcagcagctgctgccagggactggggctgtg
gttggagtttctcgagctgcttttggttctgatcgcaacagcgaatcgtttgtgggaaag
ggggaacccccatctctcagcctggttaccttcgagagtcctgattctcatgaagttgat
gaagaaacctatctggctcttgctcatcagaagtataagaatggtgactataagcaggcg
ctggagcacagtactctagtatatgagaggaattcacttcgcacggataatcttcttttg
atgggtgccatatactatcagttgagtgattttgatatgtgtattgcgaaaaacgaagaa
gctctccgtatagaaccacgttttgctgagtgttatggaaatatggctaatgcttggaag
gaaaaaggaaatatagatcttgccattcgttactatctacacgccattgagcttcgaccc
aatttttgtgatgcatggtcaaacttggctagtgcatacatgcggaaaggcaggcttggt
gaggctgcacaatgttgtcgtcaggctcttgcattgaatcctcttctggttgacgctcat
agcaacctcgggaatctcatgaaagcacaagggatggttcaagaagcgtacagctgctac
cttgaagctttacgtatacagcctacatttgctattgcatggtcgaatcttgctggtctt
ttcatggaatctggtgaccttaacagagcacttcaatactacaaggaggcagtgaagctc
aaaccccaatttccagatgcctacttgaatctggggaatgtttataaggctttgggaatg
cctcaggaggcaattgtgtgctaccaacgtgccattcagatgcgaccaaactatgctata
gcttatggtaatttggcaagtacctattacgagcaaagtcaacttgatatggcaatactt
cattacaagcaagctattacatgtgatcctagatttttggaggcctacaacaatttgggt
aatgctcttaaggagttcggcagagtggaggaggctatacaatgctacaaccaatgcctt
gctctgcaaccaagccacccacaagctcttaccaaccttgggaatatatacatggaatgg
aatatggtgcctgctgctgcttcatattataaggccacacttcgagtaactacgggactg
tcagccccctttaacaatcttgccatcatatacaagcaacagggaaattatgctgatgca
atttcttgctacaatgaggtccttcgtattgatccattggcagctgatggcctagtgaat
aggggtaacacctacaaggaaataggtagagtgagtgaagcaattcaggactacatacgg
gccattaatatccggcctaccatggccgaagcccatgctaatttagcttcagcttacaag
gacagtggacttgtagaggctgctatcaagagctataaacaagcattgcatctgcggcct
gagttccccgaggcaacatgcaaccttttgcatactttacagtgcgtctgcaattgggag
gatcgtgataaaatgtttgcggaggtagaggggatcatcaagaggcaaattaatatgtct
gtcctaccaagtgttcaaccttttcatgcaatagcttatccgattgacccattgcttgca
cttgaaattagccgcagttatgcatcacactgtttgaaaattgcatctcgattttcactt
cctagtttcaatcacccttcaccagttcccataaagcgaaatggtgggtttgagaggctt
aggattggctatgtgagcagtgactttggtaatcaccccttatcacatcttatgggatct
gtttttggcatgcacaacagagaacatgttgaggtcttttgctatgctttgagtccaaat
gataatacggagtggagacagcgaattcaatttgaagctgagcactttgtggatgtatcc
gccatgacatctgatgtgattgccaaaatgattaatgaagacaaaattcaaatactaata
aatttgaatggctatactaagggagctagaaatgaaatatttgccatgcagcctgcaccc
attcaggtatcgtacatgggatttccaggaacaacaggagccacttacatagattattta
gtgaccgatgagtttgtttcacctttacgttatgcacatatttactctgagaagatcgtt
cacctcccacactgttactttgttaatgattataagcagaaaaatttggatgcgttggat
tcaaactgccagcataaacgttcagattatgggttacctgaagggaaattcatttttgct
tgctttaatcagttgtacaaaatggatccagagatcttcaacacctggtgtaatattctt
aagcgtgtgccgaacagtgcactttggcttctcagattcccagctgctggtgaaatgaga
cttcgagcatatgctgtagctcaaggagtgcaaccagagcaaataatttttacagatgtt
gccatgaaaaatgagcacatcagacgtagtgctttggcagatttgttcctggacacgcct
ctgtgcaatgcacataccacaggaactgacatcttatgggctggtttaccgatgattacc
ctgcctctcgagaaaatggctactagggttgccgggtctctctgtcttgcaactggactg
ggagacgaaatgattgttagcagcatgaaagagtacgaggagaaggcagtaacattggca
ttgaaccggccaaaacttcaagcactcaccaacaaattgaaggcagtgaggatgacttgc
cctctatttgacacggctcgatgggtgaggaacttggagagatcatacttcaaaatgtgg
aacttgcactgttcagggcagcgtccgcaacatttcaaggtgacagaaaacaatttggaa
tatccctttgatagatag

DBGET integrated database retrieval system