KEGG   Cucumis melo (muskmelon): 103487505Help
Entry
103487505         CDS       T03195                                 

Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
cmo  Cucumis melo (muskmelon)
Pathway
cmo03030  DNA replication
cmo03410  Base excision repair
cmo03420  Nucleotide excision repair
cmo03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:cmo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    103487505
   03410 Base excision repair
    103487505
   03420 Nucleotide excision repair
    103487505
   03430 Mismatch repair
    103487505
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cmo03032]
    103487505
   03400 DNA repair and recombination proteins [BR:cmo03400]
    103487505
Enzymes [BR:cmo01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     103487505
    6.5.1.6  DNA ligase (ATP or NAD+)
     103487505
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     103487505
DNA replication proteins [BR:cmo03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    103487505
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     103487505
DNA repair and recombination proteins [BR:cmo03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     103487505
   NER (nucleotide excision repair)
    Other NER factors
     103487505
   MMR (mismatch excision repair)
    Other MMR factors
     103487505
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DRMBL DNA_ligase_A_C UBA_4 Lactamase_B_2 RMMBL
Motif
Other DBs
NCBI-GeneID: 103487505
NCBI-ProteinID: XP_008444061
UniProt: A0A1S3B9K2
LinkDB All DBs
Position
Un
AA seq 1405 aa AA seqDB search
MASESSTPKPLAIDSSLCFVTAIESFSRQLNLSLPPLKLPFRPPPFPSDFPQSKLIPNSR
FVVDAFGHAGDYSLSYFLSHFHSDHYGGLSPTWCKGIIFCSHLTARLLLEVLKVPLPFVH
PLPLRQPTTIDGCEVILVDANHCPGAVQFLFKIPCGDGKFERYVHTGDFRFFDSMRVDPV
LERFIGSDAVFLDTTYCNPKFSFPSQEESIEYIVNIIQQTGGASKGSMGNVLFLVATYVI
GKEKILLQIASRCNRKIMVDARKMTVLRVLGYGESGVFTEHESESDVHVVGWNVLGETWP
FFRPNFVRIKDIMVEKGYSKVVGFVPTGWTYELKHNKFSVRSKDSLEIHLVPYSEHSNYN
ELREYVKFLRPKRVVPTVGLDVDKLDSKHADKIKKHFAGLVDEMANRKEFLKGFHRGSGE
MSDDVDENATKAETEFQEFEEKEISSCMNISVKTDASNSGMGLSSLQEVGCTNLFESNDG
EQQKIIQELRECLPAWVTQDQILDLISSSGRNVVDAVSNFYERETEFYEHVSTLTDICPK
YPSKISDSPFTFPATDNKKVVILGKVDTSSGHASKSSSPRGTAKTKTSPGKRKRNFQDKP
KNKSRKNLSLHSGGSKQSTITKFFRKAPHLSDCSKMESIEEQNCQDQSSPNDITEYVNKM
DEFIQIINGDESLKTLVESLLVKTNGDMNMALDLYYTNPQERLGQNEKGHIFSGNPIQTE
RNSDECLSTQKKNMLENIGLETDLSKKINETFVSLPPEDYDPVKNACWRYGQPAPYIHLV
RTFDLLEEEKGKIKATSMLCNMFRSLLVLSSEDVLPAVYLCTNKIAADHENMELNIGGSL
VTAALEEACGVGRSKITEMYNELGDLGDVALACRQAQRLLAPPSPLLIKDVLSTLRKVSV
QTGSGSTARKRNLIVNLMRSCREKEIKFLVRTLVRNLRIGAMLKTVLHALSQAVFISSSL
NIYKEEMLGNLKEKLQNFSATVLDAYNVLPNFQDLIVPSLMGKGIEFSSSSLSMVPGIPI
KPMLAKITNGIPRALKIFENKAFTCEYKYDGQRAQIHKLADGSLRVFSRNSDDTTSKFPD
LIKIINELSKPAVSTFILDAEVVGVDRKNNCRLMSFQELSSRGRGNKDSLIAVDSIKVDI
CVFAFDIMLANGEQLLGLPLRDRRKYLKDLFGDGRLGYFEYAKEISIEKDDACLNCESTL
IKLNCFLGDAFHSSCEGIMVKSLDVDAGYFPSKRTDTWLKVKRDYLEGLNDSLDLVPIGA
WHGNGRKAGWFSPFLMACYNPGTGEFQSVCRVMSGFSDAFYIEMKEFFSGDKILCKKPVY
YRTAEVPDMWFLPQVVWEIRGADLTVSPVHQAAVGLVHPVRGISIRFPRFIRSVPDRNPE
ECSTATDIAEMFNSQTRKMDVASGG
NT seq 4218 nt NT seq  +upstreamnt  +downstreamnt
atggcttccgaatcttccacacctaaacccctagcaatcgactcttccctctgcttcgtc
actgctatcgaatcgttttcgcggcagctgaatttatctcttcctccgctgaagcttcca
tttcgaccccctccttttccctccgatttcccccagtctaaactcatcccaaattcccgt
ttcgtcgtggacgcatttggccacgccggcgattactctctttcatatttcctctctcat
tttcactccgatcactatggtggtctctcacctacttggtgcaagggtattatcttctgc
tcccaccttactgctcgccttttgctcgaagttctcaaagtccctctgccattcgtccac
ccattgccgcttcgacagcctacaacaatagatggctgtgaggtaatacttgttgatgcc
aatcattgtccgggtgcagtccagttcttgtttaagattccttgtggggatgggaagttt
gagagatatgttcatactggtgattttcggttttttgattctatgagagtcgaccctgtt
ttggaaaggtttattggctcggatgcggttttcttggatactacgtactgtaatccgaag
tttagttttccttcccaggaggagtctattgaatatatagttaacatcatacaacaaact
ggaggtgcaagtaagggttctatggggaacgttctttttcttgtcgcaacttatgtgatt
ggaaaggaaaaaattttgcttcaaattgcaagtagatgtaatcgtaagataatggtcgat
gctaggaaaatgacagtcttgcgtgttttgggatatggagagagcggggtgtttaccgag
catgaaagtgaaagtgatgttcatgttgttggatggaatgtgttgggtgaaacttggcct
ttttttaggcctaattttgttagaataaaggatataatggtggaaaaggggtattcgaag
gttgttggttttgttccaacagggtggacttatgagttgaaacacaacaagttctcagta
aggtccaaggattcactagagatacatctggtgccatatagtgaacactcaaactacaat
gaacttagggaatatgtgaagtttttgagacctaaaagagttgttcccactgtgggtttg
gatgttgataaacttgatagcaagcatgctgataaaattaagaaacactttgctggttta
gttgatgaaatggccaacagaaaagaattcttaaaagggtttcatcgtggatctggtgaa
atgagtgatgatgttgatgaaaatgccacaaaggctgaaactgagttccaggagttcgaa
gaaaaggaaatttcatcgtgtatgaatataagtgtcaaaaccgatgcatccaatagtggt
atgggtttgtcttctctgcaagaagttggttgtaccaatctatttgagtcaaatgatggg
gaacaacagaagattatccaggaacttcgtgagtgcttgcctgcatgggtcactcaggat
caaatattagatctgattagcagctctgggagaaatgtcgttgatgcagtttctaatttt
tatgaacgagaaactgaattttatgaacatgtttcaactctaacggatatctgtcccaag
tacccaagcaaaatatcagatagcccgtttacttttcctgcaacagataataaaaaggtg
gtcattttgggaaaagttgacacttcttcaggccatgcttcaaagtcgtccagtccaagg
gggacggccaagactaaaacttctcctggaaaaaggaagagaaactttcaagataagccc
aaaaataagtcaagaaaaaatttaagtctgcattctggtgggtctaagcaatctacaatc
acaaagttcttcaggaaagctccacatttgtctgattgttctaaaatggaatctatagaa
gagcaaaattgtcaagatcaaagttctccaaatgatattaccgaatatgtaaacaagatg
gacgagtttattcaaataataaatggtgacgagtcattaaaaacacttgttgaatcatta
ttggtaaagacaaacggagacatgaatatggcacttgatttgtattatactaatcctcag
gagaggcttggtcaaaatgaaaagggtcacatcttcagcgggaacccaatccaaactgaa
aggaattcggatgaatgcttatctactcagaagaaaaacatgctagaaaatattgggctt
gagactgatttgtctaagaagataaatgaaacttttgtatccctaccacctgaagattat
gacccagtcaagaatgcctgttggcggtatggacagcctgccccatatatacatcttgta
cgtacttttgatctgcttgaagaggaaaaagggaagataaaagctacatctatgctttgc
aatatgtttagaagtttattggttttgtcttctgaggatgtgctgcctgcagtgtattta
tgcactaacaaaattgctgctgaccatgaaaacatggaactaaatattggtgggagtttg
gtcacagcagcacttgaagaggcatgtggggttggtcgttccaagataactgaaatgtat
aacgaattaggtgatttaggagatgttgctcttgcatgtcgccaagcacagagattattg
gcacctccttcacccctcctcattaaagatgtattatctacccttcggaaagttagtgta
caaacaggtagtggaagtactgcacgtaagagaaacctgattgtcaatctcatgcgttct
tgtagagaaaaggaaatcaaatttcttgtaagaaccttggttcgtaacttacgtatagga
gccatgttgaaaactgttcttcatgctctgtcccaagctgttttcataagttcatctctc
aacatttacaaggaagaaatgttggggaatttaaaggagaagcttcagaacttctcagct
acggtgctagatgcatacaacgtgcttccaaattttcaggatctgattgttccttctctt
atgggcaaagggattgaattctcatcatcgtctctatcaatggttccaggaatacctatt
aagccaatgcttgcaaagattactaatggtattcctcgagcgttgaaaatctttgagaat
aaagcttttacatgtgaatacaaatatgatggtcagcgtgcgcaaattcacaaactggca
gatggttctttgcgagttttctctcgaaacagtgatgatacaacgtcaaaatttcctgat
ttgatcaaaataattaatgaattatctaaacctgctgtctcaactttcatactggacgcc
gaggttgttggtgttgataggaaaaataattgcagactaatgtctttccaagaattatca
tcacgtgggagagggaacaaagactcactgattgctgttgatagcataaaggtcgatatt
tgtgtgtttgcttttgacattatgcttgccaatggagagcaactgctggggttacctctc
cgggatagacgaaaatatttgaaagatttgtttggtgatggtaggctagggtattttgaa
tatgcgaaagaaatatcaattgaaaaggatgatgcctgcttaaactgtgaatccactttg
attaaattaaattgtttccttggagatgcattccattcatcatgtgaaggaattatggtc
aaatctttagatgtagatgctggatattttccctcaaagcgtacggacacatggttgaag
gtaaagcgggattatcttgaaggattgaatgattctcttgatttagtccctattggtgct
tggcatggaaatggaagaaaagctggatggttcagccctttcctcatggcttgttacaac
cctggcactggagaatttcaaagtgtatgtcgtgttatgtcaggattctctgatgcattt
tacattgagatgaaagaatttttttctggggataagattttgtgtaaaaagccagtttat
tatcgaactgctgaagttcctgatatgtggttcttgccacaagttgtttgggaaattaga
ggtgcagacttaacagtatcgccagttcaccaggctgctgtaggtttagttcatcctgtt
cgtggcatctcaatcaggtttccaagatttattcgttcggttccggatagaaatcctgaa
gaatgtagcacggctacagatatagcggaaatgtttaattctcaaacgaggaaaatggat
gttgcatcaggaggttga

DBGET integrated database retrieval system