KEGG   Cucumis melo (muskmelon): 103487718Help
Entry
103487718         CDS       T03195                                 

Definition
(RefSeq) glutamate--glyoxylate aminotransferase 2
  KO
K14272  glutamate--glyoxylate aminotransferase [EC:2.6.1.4 2.6.1.2 2.6.1.44]
Organism
cmo  Cucumis melo (muskmelon)
Pathway
cmo00260  Glycine, serine and threonine metabolism
cmo00630  Glyoxylate and dicarboxylate metabolism
cmo00710  Carbon fixation in photosynthetic organisms
cmo01100  Metabolic pathways
cmo01110  Biosynthesis of secondary metabolites
cmo01200  Carbon metabolism
cmo01210  2-Oxocarboxylic acid metabolism
cmo01230  Biosynthesis of amino acids
Module
cmo_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
cmo_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:cmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    103487718
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    103487718
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    103487718
   00260 Glycine, serine and threonine metabolism
    103487718
   00220 Arginine biosynthesis
    103487718
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cmo01007]
    103487718
Enzymes [BR:cmo01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     103487718
    2.6.1.4  glycine transaminase
     103487718
    2.6.1.44  alanine---glyoxylate transaminase
     103487718
Amino acid related enzymes [BR:cmo01007]
 Aminotransferase (transaminase)
  Class I
   103487718
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 103487718
NCBI-ProteinID: XP_008444367
UniProt: A0A1S3BAZ4
LinkDB All DBs
Position
Un
AA seq 473 aa AA seqDB search
MGLKPLDYESINENMKKVEYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
QVIALCQAPFLLDDPNVGQLFPPDAIVRAKHYLSMIGGGLGAYSDSRGNPGVRKEVAEFI
ERRDGYPSDPELIYLTDGASKGVMQILNTIIRGEGDGILVPVPQYPLYSATIALFGGSLV
PYYLDESSNWGLDVNDLRQSVARARSQGITVRAMVIINPGNPTGQCLSEANLREILNFCF
QENLALLGDEVYQQNIYQDERPFISSKKVLMDMGPPISKELQLISFHTVSKGYWGECGQR
GGYFEMTNIPPQTVDEIYKIASISLSPNVPAQVFMGLMVNPPKPGDVSYEQYHRESKGIL
ESLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIQLPPKAIETAKRAGKEADVFYCLKL
LEATGISTVPGSGFGQKEGVFHLRTTILPPEEEMPGIMASFRKFNDEFMEQYA
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgggtctgaaaccattagattatgagtctataaatgagaacatgaagaaggtagagtat
gcagttagaggagaattgtatcttcgagcatccgagcttcagaaagaaggaaaaaagatt
atctttacaaatgttgggaatcctcacgctcttggccaaaagcctttgacctttcctcgt
caggtgattgctctttgccaagcgccatttcttctagatgatcccaatgtaggacaatta
ttccctcctgatgcaatcgtcagggccaaacattatctttcaatgattgggggtggttta
ggtgcttacagtgattcccgaggaaatccaggagtaaggaaggaggtggcagagttcata
gaaaggcgtgatggctatccgagtgatccagaactgatatatctcacagatggggccagc
aaaggtgtgatgcaaatactgaatactataatccgtggtgaaggtgatgggattcttgtt
ccagtccctcagtatccactttactctgcaacaattgctctgtttggtggttccttggtt
ccatattatttagatgagagctccaactggggtcttgatgtcaatgaccttcgtcagtca
gttgcacgagctcgctctcagggaatcacggtcagagcaatggtaatcataaaccccggt
aacccaactggtcaatgccttagtgaagcaaatttaagagaaatattgaacttctgtttt
caagaaaatctagcattacttggtgatgaagtttatcagcaaaacatctatcaggatgaa
agacctttcattagttctaaaaaggtattaatggatatggggcctcccatcagcaaggaa
cttcagctcatatcattccacactgtgtcaaagggatattggggagagtgtggacaacgt
ggtggatactttgagatgacaaacattcctcctcagacagtggatgagatatacaagatt
gcatcaatatctctcagtccaaatgttcctgcacaagtgtttatgggactcatggtcaat
ccccccaaacctggtgatgtatcctatgagcaatatcatcgtgaaagcaaagggatcctt
gaatcacttaggagaagggcaaggattatgacagatggttttaacagctgcaaaaatgta
gtctgcaacttcactgaaggtgccatgtattcattccctcaaatccagttgcctcctaaa
gcaatagagacggcaaaaagagcaggaaaagaagctgacgtcttctactgtcttaagctt
ttggaagccactggaatctccaccgtcccaggctcgggatttggacagaaagaaggggtc
ttccatttgcgaacaaccatattaccgccagaggaggagatgccagggatcatggctagt
tttagaaagttcaatgatgagttcatggaacaatatgcatag

DBGET integrated database retrieval system