KEGG   Cucumis melo (muskmelon): 103488137Help
Entry
103488137         CDS       T03195                                 

Definition
(RefSeq) glucose-6-phosphate isomerase 1, chloroplastic
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Organism
cmo  Cucumis melo (muskmelon)
Pathway
cmo00010  Glycolysis / Gluconeogenesis
cmo00030  Pentose phosphate pathway
cmo00500  Starch and sucrose metabolism
cmo00520  Amino sugar and nucleotide sugar metabolism
cmo01100  Metabolic pathways
cmo01110  Biosynthesis of secondary metabolites
cmo01200  Carbon metabolism
Module
cmo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cmo_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
cmo_M00114  Ascorbate biosynthesis, plants, glucose-6P => ascorbate
Brite
KEGG Orthology (KO) [BR:cmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103488137
   00030 Pentose phosphate pathway
    103488137
   00500 Starch and sucrose metabolism
    103488137
   00520 Amino sugar and nucleotide sugar metabolism
    103488137
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cmo04147]
    103488137
Enzymes [BR:cmo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.9  glucose-6-phosphate isomerase
     103488137
Exosome [BR:cmo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   103488137
  Exosomal proteins of other body fluids (saliva and urine)
   103488137
  Exosomal proteins of colorectal cancer cells
   103488137
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PGI
Motif
Other DBs
NCBI-GeneID: 103488137
NCBI-ProteinID: XP_008444947
UniProt: A0A1S3BCF3
LinkDB All DBs
Position
Un
AA seq 624 aa AA seqDB search
MASISGICSSSPSLKPQTKTLFLGPTGSLRKDSISFPVRAKLNDGRLGSGTAHSVAKEIS
VELSAADGGFNKGKKKGLEKDPRALWSRYVDWLYQHKELGLFLDVSRIGFSDEFLAEMEP
RFQKAFKDMEALEKGAIANPDEKRMVGHYWLRNSELAPNSFLKSQINNTLDAVCKFADDI
ISGKIKPPSSPEGRFTQILSVGIGGSALGPQFVAEALAPDNPPLKIRFIDNTDPAGIDHQ
IAQLGQELETTLVIVISKSGGTPETRNGLLEVQKAFREAGLDFAKQGVAVTQENSLLDNT
ARIEGWLARFPMFDWVGGRTSEMSAVGLLPAALQGIDIREMLAGAALMDDATRSTEIRNN
PAALLALCWYWASDGVGSKDMVVLPYKDSLLLFSRYLQQLVMESLGKEFDLDGNRVNQGL
TVYGNKGSTDQHAYIQQLREGVHNFFVTFIEVLRDRPPGHDWELEPGVTCGDYLFGMLQG
TRSALYANDRESISVTVQEVTPRSVGAMVALYERAVGLYASIININAYHQPGVEAGKKAA
GEVLALQKRVLAVLNEASCKEPVEPLTLDEVAERCHAPEDIEMIYKIIAHMAANDRALIA
EGTCGSPRSIKVFLGECNVDDLYA
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atggcttccatttccggcatttgttcttcttctccgtctttgaaacctcaaaccaagacc
ctttttcttggacctactgggtcattacgcaaagattcaatctcgtttccggttcgtgcc
aagctcaatgacggtagattgggttctggtactgctcactcagttgctaaagagatctca
gttgaattgtcagctgctgatggaggttttaacaaggggaagaagaagggtttagagaaa
gatcctcgtgcactttggagtagatacgttgactggctttatcagcataaggaacttggg
ttgtttttggatgtaagtcggattgggttctcggatgagtttctagcggagatggagcct
cggtttcaaaaggcgttcaaggatatggaggcgcttgagaaaggtgcgattgctaatcca
gatgagaaacggatggttgggcattattggttgaggaactctgagcttgcacctaactcg
tttttgaagtcgcagattaataatactcttgatgctgtgtgtaaattcgcagacgatatc
atcagtggtaagattaagcccccatcttctcccgagggccgttttacccagatactttct
gttgggataggtggatcagctcttggcccgcagtttgtggctgaggcattggcgccagac
aaccctccacttaagataagatttattgacaatacagacccagcaggaattgatcatcag
attgcacaactaggacaggaattggaaactactcttgtaatagtgatctcgaagagtgga
ggcactcctgaaactagaaatggtttattggaagtacagaaggcttttcgtgaagctggc
ttggattttgcaaaacagggtgttgcggtaacacaagaaaattcattgctggataacact
gcaaggattgagggttggttagccaggttcccaatgtttgattgggtgggtggtagaaca
tcagaaatgtctgctgttggtcttcttccagctgcacttcagggaattgacattcgagaa
atgcttgctggtgctgctttgatggatgatgcaactagatcaactgagattagaaataat
cctgctgcattacttgctttgtgctggtattgggcttctgatggggtaggatctaaggat
atggttgttcttccatacaaggacagtctgctattgtttagtcgttatttgcagcaactg
gtcatggaatcccttggaaaagagtttgaccttgatggaaatcgggttaatcaggggctt
acagtatatggaaacaaagggagtacagatcaacatgcctatattcaacaactgagagaa
ggcgtgcataatttcttcgtgacatttatcgaagtgctgcgtgatagaccccctggtcat
gactgggagcttgagccaggtgttacatgtggtgactacctttttggtatgctacaggga
acaagatctgcactctatgctaatgatagggaatccatctcagtcactgttcaagaagtg
actccaagatccgtaggcgcaatggtagcactctatgaaagagctgttggattatatgcc
agcattatcaacattaatgcataccatcaacctggtgtggaagctgggaagaaagctgca
ggggaagtgcttgctctccaaaagcgtgtcttggcagtacttaatgaggccagctgtaaa
gaacctgtggaaccattgacacttgatgaagtagctgaacgttgtcatgctcctgaggat
atcgaaatgatttacaagattattgctcacatggccgccaatgatagagcactgattgct
gaaggcacttgtggctcacctcgcagcattaaggtattccttggagagtgtaatgttgat
gatctgtatgcttag

DBGET integrated database retrieval system