KEGG   Cucumis melo (muskmelon): 103489270Help
Entry
103489270         CDS       T03195                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cmo  Cucumis melo (muskmelon)
Pathway
cmo00010  Glycolysis / Gluconeogenesis
cmo00020  Citrate cycle (TCA cycle)
cmo00620  Pyruvate metabolism
cmo01100  Metabolic pathways
cmo01110  Biosynthesis of secondary metabolites
cmo01200  Carbon metabolism
Module
cmo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103489270
   00020 Citrate cycle (TCA cycle)
    103489270
   00620 Pyruvate metabolism
    103489270
Enzymes [BR:cmo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     103489270
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-GeneID: 103489270
NCBI-ProteinID: XP_008446580
UniProt: A0A1S3BFD7
LinkDB All DBs
Position
Un
AA seq 491 aa AA seqDB search
MASPFLSRAALSSNTTSIPFSFSSSVSSRLPWTSSRSHTSFPANSRRRIPVVQSKIREIF
MPALSSTMTEGKIVSWVKSEGDVLSKGESVVVVESDKADMDVETFYDGILAAIVVGEGET
APVGAPIGLLAETEEEVAEAKAKAASNSTSAPAAPAAAVSPSPPPPSSSPAPAISQPSPP
SDGPKKIVATPQAKKLAKQHKVDIGSVTGTGPFGRITPADVEAAAGIAPSKSAVRNVASP
VASEAASVAAAVPSKASAAPSNLPPPVPGSTVVPFTTMQAAVSKNMVESLSVPTFRVGYP
VSTDALDALYEKVKPKGVTMTALLAKAAAMALAQHPVVNASCKDGKSFTYNSNINIAVAV
AINGGLITPVLQDADKLDLYLLSQKWKELVEKARSKQLQPHEYNSGTFTLSNLGMFGVDR
FDAILPPGQGAIMAVGASKPTVVTDADGFFSVKSKMLVNVTADHRIVYGADLAAFLQTFA
KIVENPESLTL
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggcctcccctttcctttctcgagctgctctctccagcaacaccacctccattccattt
tccttctcttcttcagtctcttctcgcctcccatggacctcttctcgttcccacacctca
tttcctgctaattctcgtcggaggatccccgtcgttcaatccaagatccgggagattttc
atgcctgcacttagctccaccatgaccgagggaaagatcgtttcgtgggtcaaatccgaa
ggggacgttctatccaaaggcgagagcgttgtcgttgtggagtctgataaggccgacatg
gatgttgagactttctatgacggaattctcgctgctattgttgttggagaaggtgaaact
gctcctgttggagctccgattggtttattggctgagactgaagaggaagtcgctgaggct
aaggctaaagctgcgtctaattccacttcggctcctgcagctcccgcggctgctgtttct
ccctctcctccccctccctcttcgagtcctgctccggcaatatctcagccatcgcctccg
tcggatggacccaagaagattgtggctactcctcaggcgaagaagctagccaaacagcat
aaggtggacattggatcggtaactggtactggtccattcggtcgaattactcccgcggat
gtggaggctgccgctggaattgccccttcgaagtctgctgtacgcaatgtagcttcaccc
gtggcttctgaggctgcttcagtggctgccgctgttccatcgaaagcttctgcagctcct
tccaacttgcctcctccagttccaggctcgacggttgtgcccttcacgacaatgcaggcg
gcggtgtctaagaatatggtggagagtctctctgttcctacattcagagttggttatccg
gtgtccactgatgctctggatgcgctctatgagaaggtgaaaccaaagggcgtcacaatg
actgccctcttagccaaggctgccgcaatggccctcgctcagcatccagttgtaaatgca
agctgtaaagacgggaagagttttacgtataatagcaacattaatattgcagtagccgtg
gctatcaacggtgggttgataacacctgttcttcaggatgcagacaagttggacctctac
ctgctgtctcaaaaatggaaagaattggttgagaaagctagatccaagcagcttcagccc
catgaatacaattcaggaacttttactctttccaatctgggaatgtttggagtggacagg
ttcgatgctatacttcctcctggccagggagctatcatggccgttggagcatcaaagcct
actgttgtcactgatgctgatggctttttcagcgtgaaaagtaaaatgttggtcaatgtg
actgctgatcaccgaatagtttatggtgctgacttggctgccttccttcagaccttcgca
aagatagttgagaatccagaaagcctgaccttgtag

DBGET integrated database retrieval system