KEGG   Cucumis melo (muskmelon): 103491745Help
Entry
103491745         CDS       T03195                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit 2, mitochondrial
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
cmo  Cucumis melo (muskmelon)
Pathway
cmo00020  Citrate cycle (TCA cycle)
cmo00190  Oxidative phosphorylation
cmo01100  Metabolic pathways
cmo01110  Biosynthesis of secondary metabolites
cmo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    103491745
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    103491745
Enzymes [BR:cmo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     103491745
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_10 Fer4_8 Fer2 Fer4_18 Fer4_7
Motif
Other DBs
NCBI-GeneID: 103491745
NCBI-ProteinID: XP_008450036
UniProt: A0A1S3BP14
LinkDB All DBs
Position
Un
AA seq 277 aa AA seqDB search
MATGILRRVLSRVSASSPSRFVRIRAHASEAEAQQVEQKATASSNLKTFAIYRWNPDSPS
KPELQEYKIDLKECGPMVLDALIKIKNEIDPSLTFRRSCREGICGSCAMNIDGCNGLACL
TKIPSGDSSTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKSEPPVPGKEILQSKKD
RAKLDGMYECILCACCSTSCPSYWWNPESYLGPAALLHANRWISDSRDEYTKERLEAIND
EFKLYRCHTILNCARACPKGLNPGKQIQHIKSLQLLG
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggccaccggaatcctgaggcgggtattatctagggtttctgcatcttcaccttcaagg
ttcgttcgaattcgagctcacgcttctgaagctgaagctcagcaagtcgagcaaaaagcg
accgcctcgtcgaacctaaagacattcgcaatctaccgatggaaccccgatagtccttcc
aaaccagagcttcaggagtacaagatcgatctcaaagagtgcggcccaatggttcttgat
gcgcttatcaaaatcaagaacgagatcgacccgtctcttaccttccgccgctcgtgccgt
gaggggatctgcggttcctgtgcgatgaacatcgacggatgtaatgggttggcttgcttg
accaagattccctctggagattcctccacgattacgccgctgcctcatatgtttgtgatc
aaggatttagtggtggacatgaccaatttctataaccagtataagagtattgagccgtgg
ttgaagaggaaaagcgaaccgcctgtacccgggaaggagattcttcagagtaagaaagat
agagctaagttggatggaatgtatgagtgcatattgtgtgcttgctgtagtacatcatgc
cccagctattggtggaacccggagtcttatcttggaccagccgctttgctccatgccaat
aggtggataagtgatagccgtgatgaatataccaaggaacgacttgaggcaataaatgat
gaattcaagctctatcgttgtcatactattctgaactgtgcccgtgcctgtccaaagggt
ttgaaccctggaaaacagatccagcatatcaaaagtcttcagcttctgggttga

DBGET integrated database retrieval system