KEGG   Cucumis melo (muskmelon): 103492226Help
Entry
103492226         CDS       T03195                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
cmo  Cucumis melo (muskmelon)
Pathway
cmo04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:cmo00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    103492226
Enzymes [BR:cmo01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     103492226
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 103492226
NCBI-ProteinID: XP_008450736
UniProt: A0A0S2LL33
LinkDB All DBs
Position
Un
AA seq 152 aa AA seqDB search
MVKAVAVLGSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGPHGFHVHALGDTTNGCMSTG
PHFNPAGKQHGAPEDENRHAGDLGNIIVGEDGTANFTITDNQISLCGKDSIIGRAVVVHG
DPDDLGKGGHELSLSTGNAGARVACGIIGLQG
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaggctgtagctgttcttggaagtagtgagggtgtgagtggaactatctttttt
acccaagaaggagatggtccaaccactgttacgggcaatgtttctggtctcaagcccggg
cctcatggattccatgttcacgccttaggtgacacaaccaatggctgcatgtcgactggg
ccacatttcaaccctgctggaaagcaacatggtgctcccgaggacgagaaccgccatgcc
ggtgatttagggaacattatcgttggtgaagatggcacggctaacttcaccattactgac
aaccagatttctctctgtggaaaggactccattatcggaagggcggttgtggttcatgga
gaccctgatgatcttggcaagggtggacatgaactcagcttaagtacaggaaatgctggt
gctagagtagcctgtggcattattggtctgcaaggttaa

DBGET integrated database retrieval system