KEGG   Cucumis melo (muskmelon): 103492544Help
Entry
103492544         CDS       T03195                                 

Definition
(RefSeq) DNA ligase 4
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
cmo  Cucumis melo (muskmelon)
Pathway
cmo03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:cmo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    103492544
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cmo03400]
    103492544
Enzymes [BR:cmo01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     103492544
DNA repair and recombination proteins [BR:cmo03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     103492544
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N BRCT_2 DNA_ligase_A_C BRCT PTCB-BRCT DNA_ligase_IV PRF
Motif
Other DBs
NCBI-GeneID: 103492544
NCBI-ProteinID: XP_008451168
UniProt: A0A1S3BQX9
LinkDB All DBs
Position
Un
AA seq 1214 aa AA seqDB search
MSEPIKFAVLSSLFDWIQRSKSSAKKRSKFRKFLDTFCSPSHYFSAIRLILPSLDRERGT
YGLKESVLATCLIDALGMSRDSDDALRLINWRKGGAKTGANAGNFALVAAEVLQRRQGMT
PGGLTINELNDLLDRLASGENRAEKTAVLSTLIQKTNAQEMKWIVMIILKDLKLGVSEKS
IFHEFHPDAEDLFNVTCDLKLVCEKLRDRRQRHKRQDIEVGKAVRPQLASRVSNANAAWK
KLHGKEVVAECKFDGDRIQIHKNGTEVHYFSRNFLDHSEYGHGMSDVIVQNVLSTRCILD
GEMLVWDKSLNRFAEFGSNQEIARAAKDGFDSNRQLCYVAFDVLYVGDTSVIHRSLKERH
ELLRNVVKPVKGQLEVLVPNDGLNSDCAGCPWSIRAYNVDDVERFFKSTIENRDEGIVIK
DLGSKWEPGDRSGKWLKLKPDYVRAGSDLDALIIGGYYGSGRRGGEVAQFLMGLAERPPS
NAYPRRFVSFCRVGTGLTDEELDAVVNKLKPYFRKSEYPRKTAPSFYQVTNNSKERPDVW
IESPEKSIILSITSDIRTIKSEVFAAPYSLRFPRIDRVRYDKPWHECLDVQSFVELVHST
NGTTQRGTNNSGRQDSKGKYIKSIGKGRKKSVSVVPSHLLQTDITGITEDSLIFSNMLFY
IVNVPPTHSLDSLHKLIVENGGTFSMNLNNSVTHSVAADSKAGIKYEAAKRHGDVIHYSW
VLECCSQKKLLPLKPKHFLFLSDNSKKKLEEEIDEFADSYFWDLELSELKQLLSNVSISE
DVKAIDYYRGKYCPKHDWCMFVGCQIYFLPLRLSLKSDWGILLELSIRRLKVEVSFRGGK
VSDDPVSATHIVVFEIPGAPVRYETVLKSWNEAEKHAMLKDRIHIVAHQWLEDCLERAQR
LQEDSYNLNPNGKKSIENINSGMDSETPLVSEDKDNPQIPCPSMEYKDRGRNEAASGQQM
LSHSIERSGGKKRGKPATRSMQKAKSGVEQVRRAQTRKAKGPAKISEVESDSSDNTDEKT
KAETGNIGTLCTENSEKHVFKTLENEISNSKKRGRPTAGNAQREKAEAEKIRRTRARIAK
RSAKIGGSESGNNDSADEETNEEESKREKEENEKTNEFKMLEDYDSKQKGKAIEEVRADF
KFVEKPEKLEVMKDPLEAMLLDMVPSLGMSGTKSSSSSITTVVEEKKPFVENKGEAVKKK
VSYKDVASELLKDW
NT seq 3645 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaacccatcaagttcgctgttctttcaagtctctttgattggattcagcgtagc
aaatcttccgccaagaagcgttccaagttccgtaagtttctcgacactttctgctctcct
tctcactatttttccgccatccgcttgattcttcctagccttgatcgagagcgcggcacc
tatggcctcaaggaatctgtacttgccacttgcctcattgatgctcttggcatgtctaga
gactctgacgacgctcttcgtcttatcaactggcgtaaaggtggtgctaagactggtgct
aatgccggtaatttcgcgcttgttgcggctgaggtattgcagcgcaggcaaggaatgacc
cctggtggtctaacgattaatgagttgaatgatttgctggatcgtttggcttcaggtgaa
aacagagcagagaaaacggcagttttgtctacccttatacagaagacaaatgcacaggaa
atgaaatggattgtcatgataatcctcaaagatctaaaactgggagtcagtgaaaagagc
atttttcatgagtttcatccagatgcagaagacttgttcaatgtcacctgtgacttaaaa
ttggtttgtgaaaaactaagggatcgtagacaaaggcataagcgtcaggacattgaagtt
ggaaaagctgtacgaccccagctggcttcaagagtgtccaatgcaaatgctgcatggaaa
aagcttcatgggaaggaagttgtagctgaatgcaagtttgatggtgaccgtattcaaatt
cataagaatggaactgaagtacactatttttcaaggaactttctcgatcactcagaatat
ggacatggaatgtctgatgttattgttcaaaatgttctttccactaggtgtatacttgat
ggtgaaatgttggtgtgggataaatctttaaatcgttttgcagagtttggctcaaaccag
gaaatagcaagggcagcgaaggatggatttgacagcaatcggcagttatgctatgttgcg
tttgatgttctttatgttggagatacaagtgttattcacaggagtttgaaagaaagacat
gagcttctcaggaatgttgtcaagcctgtgaagggtcaattggaagtcttagtacctaat
gatgggcttaatagcgactgtgctggctgtccttggtcaattagagcttataatgttgat
gacgtggaaagattctttaagagtacaattgaaaatagagatgaaggtattgttattaag
gacttgggttctaaatgggaacccggtgaccgtagtgggaagtggttaaaattaaagccc
gactatgttcgtgctggatctgatttggatgccctcatcataggaggttactacggctct
ggacggcggggtggggaggttgctcaatttttaatgggtcttgctgagcgtccaccctca
aatgcatatcccagacggtttgtttccttctgcagagtaggaactgggcttactgatgag
gagttagatgctgttgtaaataaactgaagccttattttaggaaaagtgaatatccaagg
aagactgcacccagcttttaccaagttacaaataattcaaaagaaagaccagacgtttgg
attgaaagcccagagaaatcaatcattctttccattaccagtgatattcgaactataaaa
tctgaggtatttgcagcaccatatagtctcagatttccacgcatagaccgcgttcgatat
gacaaaccttggcatgaatgtcttgatgttcaatcttttgtggagctggttcattcaact
aacggtaccacacaaaggggcacaaataatagtggtcggcaagatagtaaagggaagtac
attaagtccattggaaagggaaggaaaaagagcgtttctgttgttccttctcatttgctt
cagactgatattacaggcattacagaggactccttgattttctcaaatatgttattttac
attgttaatgtgcctccaacccattctcttgattccttgcacaaattgatagtggagaat
gggggtacattctctatgaatttgaataattctgttacacattcggtagctgccgatagc
aaagcaggcatcaaatacgaagctgccaagcgtcatggagatgttattcattattcttgg
gttttggaatgttgttcccaaaagaagctgctacctctaaagcccaagcattttctcttt
ctctctgataactcaaagaaaaaattggaggaggaaattgatgaatttgctgactcgtat
ttctgggatcttgaactttcagaactgaaacagctattaagcaacgttagcatatcagaa
gatgtgaaagccattgactactataggggaaaatattgtccaaaacacgattggtgtatg
tttgttgggtgccaaatctactttcttccattaagattatctttaaaatctgattggggc
attttgttggagctttcaataaggaggttgaaggttgaagtttcctttagaggtggaaaa
gtcagtgatgaccctgtttctgctacccacattgtagtcttcgaaatacctggagcgcct
gtaagatatgaaacagtgttgaaaagttggaatgaagcagaaaaacatgccatgttgaaa
gataggattcatattgttgcacatcagtggttggaagactgtttggagagggcccaaagg
ttgcaagaagattcatataacttgaatcccaatgggaaaaagtccattgaaaatataaat
tctggcatggattctgagacaccattggtctcggaagataaagacaatccgcaaattccc
tgcccttccatggagtacaaagatcgaggaagaaatgaagctgcttcaggacaacagatg
ctctcccattcaattgagagatctggtggaaagaaaagaggtaagcctgctacaaggagc
atgcagaaagcgaaatcaggtgtcgaacaggttcgaagagctcaaacccgaaaggccaag
gggccagcaaaaataagtgaagttgagtctgacagcagtgacaataccgatgaaaaaaca
aaagctgaaactggaaatattggaacattatgcactgaaaactcagaaaagcacgtgttt
aaaacattagaaaacgagatatctaactcaaagaaacgaggaagacctactgcagggaat
gcgcagagagagaaagcagaggccgaaaaaattcgaagaactcgggcacgtattgccaag
aggtctgcaaaaataggtggtagtgagtcaggcaacaatgactctgctgatgaagaaaca
aacgaagaagaatctaaaagggagaaagaggaaaacgagaaaacgaatgaatttaaaatg
ctagaagactatgattcaaaacaaaaaggcaaagccattgaagaagttcgtgcagacttc
aaatttgtggaaaaacctgagaagcttgaagtgatgaaggatccacttgaagcaatgttg
ttagatatggttccaagtcttggaatgagtggaactaaaagtagtagtagtagtattact
actgttgttgaggagaagaaaccatttgtagaaaacaaaggtgaggcagttaagaagaaa
gtgagctacaaggatgttgccagtgaactgcttaaggattggtaa

DBGET integrated database retrieval system