KEGG   Cucumis melo (muskmelon): 103492983Help
Entry
103492983         CDS       T03195                                 

Definition
(RefSeq) glutathione S-transferase U25-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cmo  Cucumis melo (muskmelon)
Pathway
cmo00480  Glutathione metabolism
cmo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    103492983
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cmo02000]
    103492983
Enzymes [BR:cmo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     103492983
Transporters [BR:cmo02000]
 Other Transporters
  Pores ion channels [TC:1]
   103492983
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_N_4 GST_C_3 GST_C_6 Ectatomin
Motif
Other DBs
NCBI-GeneID: 103492983
NCBI-ProteinID: XP_008451812
UniProt: A0A1S3BSC1
LinkDB All DBs
Position
Un
AA seq 218 aa AA seqDB search
MADEVKILDFWPSMFGMRVRVALAEKGVGYECIEEDLSNKSPLLLQMNPIHKKIPVLIHN
GKPICESAIIVEYIDEFWNDRAPLLPSDPYERAQARFWVDFIDKKLYGSVRKIYGGKGEE
QEEGKKEMMEILKELEKVLGEKDYFGGECFGVLDVSLVGFSTWFGGLESVGNFSIETECP
KLVSWAKRCSQKESVSKSLPDSNKISEFIVQFRKKIVG
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgaagtgaaaatcctggatttctggcccagcatgtttgggatgagagttaga
gtagctttggcagagaagggtgtgggttatgagtgtatcgaagaagatctgagtaacaag
agccctttgcttcttcaaatgaatccaattcataagaaaatcccagttcttattcataat
ggaaaacccatttgtgaatctgccattattgttgagtatatcgatgaattttggaatgac
agggctcctctgttgccgtccgatccttatgaacgagctcaagccagattttgggttgat
ttcatcgataagaagctttatggaagtgtgaggaagatatatggtggaaaaggagaggag
caagaggaagggaaaaaggagatgatggaaatattgaaggaattagaaaaagtgcttgga
gaaaaggattattttggaggtgaatgttttggagttttagacgtatctttggttggattt
tcaacttggtttggtggtttagagagcgttggaaatttcagcattgaaactgagtgtcca
aagttagtgagttgggcgaaaagatgttcacaaaaggagagcgtttctaaatccctacct
gactctaacaagatttctgagtttattgttcaattcaggaaaaagattgttgggtaa

DBGET integrated database retrieval system