KEGG   Cucumis melo (muskmelon): 103493917Help
Entry
103493917         CDS       T03195                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B4, mitochondrial-like
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
cmo  Cucumis melo (muskmelon)
Pathway
cmo00010  Glycolysis / Gluconeogenesis
cmo00053  Ascorbate and aldarate metabolism
cmo00071  Fatty acid degradation
cmo00280  Valine, leucine and isoleucine degradation
cmo00310  Lysine degradation
cmo00330  Arginine and proline metabolism
cmo00340  Histidine metabolism
cmo00380  Tryptophan metabolism
cmo00410  beta-Alanine metabolism
cmo00561  Glycerolipid metabolism
cmo00620  Pyruvate metabolism
cmo01100  Metabolic pathways
cmo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cmo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103493917
   00053 Ascorbate and aldarate metabolism
    103493917
   00620 Pyruvate metabolism
    103493917
  Lipid metabolism
   00071 Fatty acid degradation
    103493917
   00561 Glycerolipid metabolism
    103493917
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    103493917
   00310 Lysine degradation
    103493917
   00330 Arginine and proline metabolism
    103493917
   00340 Histidine metabolism
    103493917
   00380 Tryptophan metabolism
    103493917
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    103493917
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    103493917
Enzymes [BR:cmo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     103493917
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 103493917
NCBI-ProteinID: XP_008453101
UniProt: A0A1S3BWJ4
LinkDB All DBs
Position
Un
AA seq 554 aa AA seqDB search
MAAARRGISSLLSRSILASSSSSSSSSSSTVNGFGSLLHSHGRVSRFLGRGNGFGTSALA
EEELITPPVQINYTQNLINGQFVDSASGKTFPTYDPRTGEVIAHVAEGDAEDINRAVSAA
RKAFDEGPWPRMSAYERSRILLRFADLIEKHAPELSALETWNNGKPYEQSLKSELPLLVR
LFHYYAGWADKIHGLTVPADGNHHVQVLHEPIGVAGQIIPWNFPLIMFAWKVGPALACGN
TIVLKTAEQTPLTALYVAKLLHEAGLPPGVLNVVSGYGPTAGAALASHMDVDKLAFTGST
STGKVVLELAAKSNLKPVTLELGGKSPFIVCEDADVDKAVELAHFALFFNQGQCCCAGSR
TFVHERVYEEFVEKSKARAQRRVVGDPFKKGVEQGPQIDLEQFEKVLRYIKSGIESNATL
ECGGGRLGSKGYFIEPTVFSNVKDDMLIAKDEIFGPVQSILKFKDIDEVIHRANSTRYGL
ASGVFTSNIDTANTLTRGLRTGTVWVNCFDIFDAAIPFGGYKMSGIGREKGIYSLQNYLQ
VKAVVTPLKNPAWL
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atggcagctgctcgtagaggaatctcttctttactctctcgttctatcttagcttcttct
tcttcttcttcttcttcttcttcttctactgttaatgggtttggttctcttcttcattct
catggaagagtttcaaggttccttggaagaggaaatggatttggcacatctgctttggca
gaggaagaacttatcactcctcctgttcagataaattacactcaaaatctgatcaatggc
cagtttgttgattctgcatccggaaaaacgtttccaacttacgatcctcgcactggggaa
gtgattgctcatgttgccgagggtgatgctgaggatatcaaccgtgcagtatcagctgca
cgaaaggctttcgacgaggggccatggccaagaatgtctgcttatgaacgatcaaggata
ttgttacggtttgcagatttgattgagaaacatgctcctgaactttcagcattggaaaca
tggaacaatgggaaaccttacgaacaatcgcttaaatctgaattaccgttactcgtacgc
ttgtttcactattatgcaggctgggccgacaaaatccatggattaacagttccagctgat
ggaaatcatcatgttcaagtattgcatgaaccaattggagttgcaggacaaataattcca
tggaactttcctcttattatgtttgcttggaaagttggtcctgctttagcttgtggcaac
accattgtcctaaaaactgcagagcaaacacctctgactgctctttatgtggctaagtta
ttacatgaggcaggtcttcctccaggggttctgaatgtcgtttcaggctatggtccgacc
gcaggtgctgctcttgctagccatatggatgtggacaagctagctttcacaggatcgaca
agcacaggaaaagttgtgcttgaattggcagcaaagagcaatttgaagccagtgacacta
gagcttggagggaaatcacctttcattgtttgtgaggatgcagatgttgataaggctgtg
gagcttgctcattttgctctttttttcaatcaggggcaatgttgttgtgctgggtctcgt
acctttgtgcacgagcgcgtatacgaagaatttgtcgaaaagtcgaaggcacgtgcccaa
agacgtgttgttggtgaccctttcaagaagggcgttgaacagggtcctcagattgacttg
gagcaattcgaaaaagtcctaagatatatcaaatctggcattgaaagcaacgctactttg
gaatgtgggggtggtagacttgggtccaagggatacttcatcgagccaacagttttctca
aatgttaaggacgatatgttgatagcaaaggatgaaatctttggtccagtacaatccatc
ttgaaattcaaggacattgatgaagtaattcatagggcaaactcaactcgttacggtcta
gcatcaggagttttcacttcgaacatcgacacagccaacacactaacacgagggttgaga
acggggaccgtgtgggtcaattgcttcgacatattcgatgccgcgataccatttggcggg
tataagatgagtggaataggaagggagaagggaatttacagcctccaaaactacttacaa
gtgaaggctgttgttacacctctcaagaatccagcatggttgtga

DBGET integrated database retrieval system