KEGG   Cucumis melo (muskmelon): 103494038Help
Entry
103494038         CDS       T03195                                 

Definition
(RefSeq) histone deacetylase 5
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
cmo  Cucumis melo (muskmelon)
Brite
KEGG Orthology (KO) [BR:cmo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:cmo01009]
    103494038
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:cmo03019]
    103494038
   04131 Membrane trafficking [BR:cmo04131]
    103494038
   03036 Chromosome and associated proteins [BR:cmo03036]
    103494038
Enzymes [BR:cmo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     103494038
Protein phosphatases and associated proteins [BR:cmo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103494038
Messenger RNA biogenesis [BR:cmo03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     103494038
Membrane trafficking [BR:cmo04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    103494038
Chromosome and associated proteins [BR:cmo03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     103494038
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 103494038
NCBI-ProteinID: XP_008453265
UniProt: A0A1S3BWL5
LinkDB All DBs
Position
Un
AA seq 658 aa AA seqDB search
MDVDDSETTKFNGINGDSRRLGVLYDERMCKHHTPDGDYHPENPYRIRAIWNKLHAAGIL
QRCVVLKGKEAEDKHILAVHSKNHVKLIKKISSKEFDSQRDKIAAKLNSIYFNEGSSEAA
YLAAGSVIDVAEKVAEGDLDSGIAIVRPPGHHAEHDEAMGFCLFNNIAVAASFILNERPD
LGIKKILIVDWDVHHGNATQKMFWEDPRVLFFSVHRHEFGSFYPATHDGFYTQVGEGPGA
GYNINVPWENGRCGDADYLAVWDHILLPVAEEYNPDMIMVSAGFDAAVGDPLGGCCVTPY
GYSIMLKKLMNLAQGKIVLALEGGYNLDSIANSMLACAELLLDGRTVNKSSETYPFESTW
QVIQAVRQELSPFWPILSDEIPDNLISKKVPLPEVLLSSSDSDDEANGRLKTLEEVLQGI
TFSQLEVKEDSQGQAVNVTQPWRSELSKTDIWYAAFGSNLWCPRLLCYIRGGQVEGMKRQ
CTGSMDTTPPKEILWKSFPHRLFFGREYSSTWGQGGVAFLNPESNSEEKSYLCLYRITLE
QFNDLLYQENNASGTLSDNPLLDIANLNKVTSSPSNSIEVPTGKGWYHNLLYLGKECNIP
ILTMTCSHSDMEGFKSGKIPICSPAKEYVNTLVRGLAEGPLSKEEASEYIQKASTKPL
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atggacgttgatgactccgaaactacgaaattcaacggaatcaatggcgattcacggagg
ttaggagttctgtacgacgagaggatgtgcaaacatcacacacccgacggagattaccat
cctgagaatccttatcgaattagggccatttggaacaagctacacgccgctggcattctt
cagaggtgtgtggtcttgaaagggaaagaagcagaagataagcatattttggcagttcac
tccaaaaatcatgttaagttgattaagaaaataagctccaaagagtttgattcacaaaga
gataagatcgccgcaaaacttaactccatatacttcaatgaagggtcatccgaagctgct
tatctggctgctggctctgtcatagatgttgctgaaaaagtagctgaaggagacttagat
tctggcattgcgattgtgaggccgccgggtcatcatgctgaacatgatgaagctatgggg
ttttgtttgttcaacaatatagctgtggcagcaagctttattttgaatgaaagaccagat
ttgggtattaagaaaattttaattgtggattgggatgttcatcatggcaatgcaacgcaa
aagatgttctgggaggatccccgtgttttgttcttctctgttcaccggcatgaatttgga
agtttctatccagccacacatgatggtttttatacccaggttggagaaggacctggagca
ggttataatataaacgtcccttgggagaatgggcgatgtggggacgctgactacctagca
gtttgggaccatatcttgcttcctgttgctgaggaatacaaccctgatatgatcatggtc
tctgctggatttgatgcagctgttggggatcctctgggtggttgctgtgtcacaccatat
ggatactcgattatgttgaaaaagttgatgaatcttgcacaaggaaagattgtattggcc
ctggaaggaggatataatctcgactctatagcaaattcaatgcttgcctgtgcggagttg
ctgcttgatggaagaactgtgaataagtcttcagagacttatccatttgagtcaacatgg
caagtgatccaagcagttcgccaagaactgagtcctttttggccaattctttcagatgaa
ataccagacaatttgatcagtaaaaaggtgccactcccggaggtattgctttcaagctct
gattcagatgatgaagctaatggtagattaaaaaccctcgaggaagttcttcagggtatc
acattttcacaattggaagttaaggaagacagtcagggtcaagcagttaatgttactcag
ccttggagatcggagctatcgaaaaccgatatctggtatgctgcatttggatcaaatttg
tggtgcccaagattactttgttatataagaggaggacaggttgagggtatgaagagacaa
tgtacaggttcaatggatacgactccaccaaaggagattctgtggaaatcgtttcctcat
cgtctatttttcggtcgtgagtatagcagtacatggggccaagggggagttgcttttctt
aatcctgaaagcaacagcgaggagaaatcttacttgtgcttgtatagaattacgcttgag
caatttaacgaccttttgtatcaagaaaataatgctagcggtaccctttctgataaccct
ttattggatatagctaatttgaacaaagtcacaagcagcccttccaactctattgaggtt
ccaactgggaaaggctggtaccacaacctcctatatttggggaaagaatgcaatattcca
atactaactatgacatgttcacattcggatatggaaggcttcaaatctggaaaaattcca
atctgttcgccagcaaaagagtacgttaatacccttgttagaggccttgcagaagggcca
ctttcaaaggaggaagcatcggaatatattcagaaggcttcaactaagccactgtaa

DBGET integrated database retrieval system