KEGG   Cucumis melo (muskmelon): 103494381Help
Entry
103494381         CDS       T03195                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
cmo  Cucumis melo (muskmelon)
Pathway
cmo00020  Citrate cycle (TCA cycle)
cmo00190  Oxidative phosphorylation
cmo01100  Metabolic pathways
cmo01110  Biosynthesis of secondary metabolites
cmo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    103494381
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    103494381
Enzymes [BR:cmo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     103494381
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 DAO FAD_binding_3 Lycopene_cycl HI0933_like
Motif
Other DBs
NCBI-GeneID: 103494381
NCBI-ProteinID: XP_008453738
UniProt: A0A1S3BY61
LinkDB All DBs
Position
Un
AA seq 635 aa AA seqDB search
MWRCVSRGLRASSSFSTKSPPNDHLRSQFSRFFSADSTAGRSSYTVVDHTYDAVVVGAGG
AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSD
WLGDQDAIQYMCREAPKAVIELENYGLPFSRTETGKIYQRAFGGQSLDFGKGGQAYRCAC
AADRTGHALLHTLYGQAMKHNTQFFVEYFALDLLMNSDGSCQGVIALNMEDGTLHRFRAA
STILATGGYGRAYFSATSAHTCTGDGNAMVARAGLPLEDLEFVQFHPTGIYGAGCLITEG
SRGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNH
LPPDVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTIKGNDPD
AVIPGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEIGRPGAKQKPLEKDAG
EKTIAWLDKLRNANGSLPTSKIRLNMQRIMQNNAAVFRTQETLEEGCKLIDKAWESFHDV
QVKDRNLIWNTDLIETIELENLLINACITMHSAEARKESRGAHAREDFTKRDDENWMKHT
LGFWENEKVRLDYRPVHMNTLDDEVETFPPKARVY
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgctgtgtttctcgtggtcttcgcgcttcttcttccttttccacgaaatcgccc
cccaatgatcacctcagatctcaattttctagattcttctccgccgattcgacggcaggt
cgctcctcatacactgtggttgatcacacatacgatgcggtcgtggtaggtgcgggtggt
gcagggcttcgagctgctatcgggttgtcagagcatggatttaatactgcttgcattact
aagcttttcccaacccgttctcacacggttgcagctcagggaggtataaatgctgcactg
ggaaacatgactgaggatgattggaggtggcacatgtacgacactgtcaaggggagtgat
tggctaggtgatcaggatgccattcaatacatgtgtagagaagcaccgaaagcagttatt
gagcttgagaattatgggcttccattttctcgtactgaaactggaaagatatatcaacgt
gcatttggtggccagagtctcgactttggaaagggtggacaggcatatcgttgtgcatgt
gctgctgaccgaacagggcatgctttattacatactctctatggccaggctatgaagcat
aacacacagtttttcgtggaatatttcgctttggatctattaatgaatagtgatggtagc
tgccagggagtgatagcattaaatatggaggatggtacactacatcggttccgagctgca
tcaacaattttggcaactgggggttatggcagagcatatttctcagcaacctctgctcat
acttgcactggagatggaaatgccatggttgcacgagctgggcttccacttgaggatttg
gagtttgtgcagtttcatccaacgggaatttatggtgctgggtgcctcattactgaagga
tctcgtggtgaaggtggcattcttaggaacagtgaaggtgagcgctttatggaacgatat
gccccaacagcaaaggatcttgcatcaagagatgttgtgtctagatccatgactatggaa
attcgggagggtcgtggcgttggacctttgaaggaccacatctatcttcatttaaatcac
ttacccccagatgtactgaaggagaggcttccgggtatctcagaaactgctgccattttt
gctggcgttgatgtcaccaaagaacccattccagttttaccaaccgtgcattataatatg
ggtggaattcccacgaatcatcatggagaggtagttacaattaagggaaacgatccagat
gccgttattccaggattgatggctgctggggaggcagcttgtgcctcggttcatggtgcc
aataggcttggtgcaaattcacttttggacattgttgtctttggacgagcttgtgccaac
agggttgcagagattggtagaccaggggcaaagcaaaagccattggaaaaagatgctggt
gagaagaccattgcatggctagacaagttaagaaacgcaaatggttcactgcccacctca
aagattcgtttgaacatgcaacgaattatgcaaaacaatgctgctgttttccgaacgcag
gagaccttggaagaaggttgcaaactaattgacaaggcctgggagagtttccatgatgtt
caggtcaaggacaggaatttaatatggaacactgatttgatagagaccattgaattggaa
aatcttttgataaatgcatgtattactatgcactctgctgaagccaggaaagagagcaga
ggagcacatgcccgtgaagatttcacgaaaagagacgatgagaactggatgaaacacact
ctaggattctgggaaaatgagaaggtcagactggactataggcctgtgcacatgaacacg
ttggacgatgaggtcgaaacattccctcccaaggctcgtgtatactga

DBGET integrated database retrieval system