KEGG   Cucumis melo (muskmelon): 103495405Help
Entry
103495405         CDS       T03195                                 

Definition
(RefSeq) phospho-2-dehydro-3-deoxyheptonate aldolase 2, chloroplastic-like
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
cmo  Cucumis melo (muskmelon)
Pathway
cmo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cmo01100  Metabolic pathways
cmo01110  Biosynthesis of secondary metabolites
cmo01230  Biosynthesis of amino acids
Module
cmo_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:cmo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    103495405
Enzymes [BR:cmo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     103495405
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAHP_synth_2
Motif
Other DBs
NCBI-GeneID: 103495405
NCBI-ProteinID: XP_008455172
UniProt: A0A1S3C112
LinkDB All DBs
Position
Un
AA seq 515 aa AA seqDB search
MALPTTTPLPKSLPHPLFPITSKTPHHRRLSPSARSSKPISAIHAADPSRSSKSSIQVPT
KWTLDSWKSMRALQLPEYPDQAALESVLRTLESFPPIVFAGEARSLEDRLAQAAVGKAFL
LQGGDCAESFKEFNANNIRDTFRVLLQMSVVLMFGGQMPVIKVGRMAGQFAKPRSDPYEE
KDGVKLPSYRGDNINGDSFDKQSRIPDPDRMNRAYCQSVATLNLLRAFATGGYAAMQRVT
QWNLDFTEHSEQGDRYRELAHRVDEALGFMAASGLTVDHPIMTSTEFWTSHECLLLPYEQ
ALTREDSTSGLYYDCSAHMLWVGERTRQLDGAHVEFLRGVANPLGIKASDKIDPKELVKL
IDILNPRNKPGRIVVIVRMGAENMRVKLPHLIREVRRAGQIVTWVSDPMHGNTIKAPCGL
KTRSFDAIRAEVRAFFDVHDQEGSYPGGVHLEMTGQNVTECVGGSRTITYNDLSSRYHTH
CDPRLNASQSLELAFIIAERLRRRRLVAGQALASV
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcccaaccactacccctctcccaaaatctctcccccatcccctttttccgatc
acctccaaaaccccccaccaccgccgtctttccccttccgcccgatcctcaaaacccatc
tccgccattcatgctgccgacccatcaaggtcgtccaaatcatctatccaggtcccgacg
aaatggaccctcgatagctggaagtcgatgagggctctgcaacttcccgaatatcccgat
caggcggcgcttgaatctgtcctcaggacacttgaatcttttccgccgatcgtctttgcc
ggagaagctaggtccttggaggaccggctggcgcaggcggctgtggggaaggcttttctt
ctccaaggtggggattgtgctgagagctttaaggagtttaatgccaataacattcgtgat
actttccgtgttctgctgcagatgagtgttgttcttatgtttggtggtcaaatgccggtt
attaaggtaggaagaatggcaggtcagtttgcaaagccaagatcagacccgtacgaggag
aaggatggagtgaaactcccaagctacagaggagacaatataaatggtgattcgtttgat
aagcaatctaggattccagacccagatcgaatgaatagagcctactgccagtcagtggca
acattgaacctcttgagggcctttgccacgggaggttatgctgcaatgcagagagttacg
caatggaatcttgatttcaccgagcatagtgagcagggtgatagataccgagaactagcc
catagagttgatgaggcccttggattcatggctgcttctggactcactgtggatcaccct
atcatgacctcgactgagttctggacatctcatgagtgtttgctcctcccttacgagcaa
gcacttactagggaggattccacttctgggctttactatgactgctcggctcacatgctt
tgggttggagaacgaactagacaacttgatggtgcacacgttgagtttttgagaggtgtt
gctaatcctcttggcattaaggcaagtgataagattgatccaaaggaattggtcaagctt
attgacattctaaatcccaggaacaagcctggaagaattgtagtgatagtaagaatggga
gctgaaaacatgagagtgaaacttccacatttaatcagggaagtacggcgagctggtcaa
atcgtcacatgggtcagcgatcccatgcacgggaatacaatcaaagccccctgtggacta
aaaacacgttcatttgatgctattagggctgaggtgagagcattcttcgatgtacacgat
caagagggaagctaccctggaggagttcatttggagatgacagggcagaatgtaaccgaa
tgcgttggaggctcacgaactataacttataatgatctgagctcacggtaccatactcac
tgcgaccccagactcaatgcttctcagtctctagagcttgccttcatcatcgccgagcgg
ttgagaagaagaagactcgtagcaggacaggctttggcatcggtctga

DBGET integrated database retrieval system