KEGG   Cucumis melo (muskmelon): 103495777Help
Entry
103495777         CDS       T03195                                 

Definition
(RefSeq) uncharacterized LOC103495777
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
cmo  Cucumis melo (muskmelon)
Pathway
cmo00500  Starch and sucrose metabolism
cmo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    103495777
Enzymes [BR:cmo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     103495777
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amyl_C2 Alpha-amylase OstA
Motif
Other DBs
NCBI-GeneID: 103495777
NCBI-ProteinID: XP_008455663
UniProt: A0A1S3C1E0
LinkDB All DBs
Position
Un
AA seq 973 aa AA seqDB search
MGPFPLLDTAIEIFPRCPIITSRSSYGRRSSHCHLLVTTVSATRNWKVSYIENLQSKPKT
VVFSSRDNSNDHLTDLVNDADGFTTGRSEVLETGEDEILAVKKALLESQTRQKAVEKERD
QLLERLARYEAKQKEYVATILHDKELAISELEAARSLFNKKLEESVGEKFALESKLVLAK
QDAIDLAVQVEKLAAIAFQQATSHILEDAQYRVSVAETSAIETSYEIEKQIRDATEGSML
SFLEQSKIAIEKALDVAEKASVHAKKAMATFTDEVYPLDGITSIQSENIKLKGVVNELES
HLSLARTDVDNLKLELENARAQATASEIRAKNAEKVLVEFQELSREKINQQEGEIKLMME
KIKKDVADKKKAASKAFKVELEGIKSAIQAAKETAHSKDSAYMRRCEALQRLLRASEAAT
KMWQQRADMAESFLLKERTMGKDNEDAAYIVNGGRIDLLTDDESQKWKLLTDGPRREIPQ
WMARRIGTIRPKFPPRKIDVTEISASKFRSLDLPKLEEVWSIAQEKPKVGDALIEHVIEK
ETIEKKRKALERALQRKTKQWQRTPDQTKLEPGTGTGHEIVFQGFNWESWRRRWYLELAA
KASDLSQSGITAVWLPPPTESVAPQGYMPSDLYNLNSSYGTEEELKYCIEEFHSQDLLAL
GDVVLNHRCAHKQSPNGVWNIFGGKLPWGPEAIVCDDPNFQGRGNPSSGDIFHAAPNIDH
SQDFVRRDIKEWLNWLRNDIGFDGWRLDFVRGFSGTYVKEYIETSNPAFAIGEYWDSLAY
EHGNLCYNQDAHRQRIVNWINATGGTSSAFDVTTKGILHSALHNQYWRMIDPQGKPTGVV
GWWPSRAVTFLENHDTGSTQGHWPFPRDKLAQGYAYILTHPGTPTIFYDHFYDFGIREMI
NELIEARQRAGIHCRSSVKIYHANNEGYVAQVGDTLVMKLGHFDWNPSKENHLDGNWQKF
VDKGSDYQLWLRQ
NT seq 2922 nt NT seq  +upstreamnt  +downstreamnt
atgggtccattcccattacttgatacggcaattgaaatcttcccgcgttgccccattatc
acttcgagatcttcatatggtaggcggtcatcacattgccatctccttgtaactacagtt
tcagctacgaggaactggaaagtctcatacattgaaaacttgcagtctaaaccaaaaact
gttgtcttttctagtcgggacaattcaaatgatcatttaacagatttggtaaatgatgcc
gatggctttacaactggaagaagtgaagtcttggagactggagaggatgaaattctagca
gttaaaaaagcgcttttggagtctcaaacaagacaaaaagctgtagagaaagagagagat
caactgcttgagaggttggctcgctatgaggctaaacaaaaagaatatgttgctactata
ttgcatgataaggaattggcaatttcagaacttgaggcggccagatcactctttaataaa
aaactcgaggaatcagtaggtgagaagtttgctttggagtctaagctggttcttgcaaag
caggatgctattgatcttgcagtgcaagttgaaaagttagccgcaattgccttccagcag
gccacctcgcacatattggaagatgctcaatatagagtctcagttgcagaaacttctgct
attgagacgtcttatgaaattgaaaaacagatcagggatgctactgaaggttcaatgctg
tcatttttagaacaatcaaaaatagctattgagaaggctctggatgtggctgaaaaagct
agtgttcatgcaaagaaggctatggctacatttactgatgaggtatatcctttagatggg
attacctctatccaatcagaaaatattaagttgaaaggtgtcgtcaatgaattggaatct
cacttatcacttgcaagaactgatgtcgataacctcaaattggaactggagaacgcccga
gcacaagcaactgcctcagaaattcgagccaaaaatgctgagaaagtattggtcgaattt
caggagttgagcagggaaaagatcaatcaacaggaaggagaaattaaattgatgatggag
aaaatcaagaaagatgtagcagacaagaagaaagctgcttccaaagctttcaaggttgaa
cttgaaggtattaagtctgccattcaagctgccaaagaaactgcacattcaaaggacagc
gcatatatgagaagatgtgaagcactgcaaagattattgagggcatcagaagctgcaaca
aagatgtggcaacaacgagctgatatggctgagtcatttttattgaaggaaagaaccatg
ggtaaggataatgaagatgcagcttatattgtcaatggtgggcggatagacctcctgaca
gatgatgagtcacaaaagtggaaactcttgaccgatggtcctcgaagagagatacctcaa
tggatggctagaagaatcggaacaattcgtcccaagtttcctcctagaaagattgatgta
acagaaatttcagcatcaaagtttagatcgttggacttgcccaaactcgaagaagtatgg
tcaattgctcaagaaaagccaaaagtaggggatgcactaattgagcatgttattgagaaa
gaaacaatagaaaagaaaagaaaggctcttgagcgtgcactgcaacgaaagaccaaacaa
tggcagaggactcctgatcaaacaaaattagaaccaggaactggaactggacacgagatt
gtgtttcaaggtttcaactgggaaagctggagaagacgctggtacctggagttagctgct
aaagcatctgatttatctcagtctgggataacagcagtgtggctcccaccaccgacggag
tctgttgctccacaaggttatatgccatctgacctatataatctgaactcatcttacgga
actgaggaggaactcaagtactgtatagaagaatttcattctcaagatcttctggccctt
ggtgatgttgtactcaatcatagatgtgcacacaagcagagtcccaatggggtttggaac
attttcggtggtaagcttccttgggggcctgaagcaattgtttgtgacgatccgaatttt
cagggtcgaggaaatccttcaagtggcgacatcttccatgcagcaccaaatattgatcac
tcccaggactttgtgaggagggacataaaagaatggctaaattggcttcgcaatgatatt
ggttttgatgggtggcgtcttgattttgtgaggggtttctcaggtacatatgttaaagaa
tatattgagacttcaaaccctgcttttgctattggagaatactgggacagtttggcttat
gaacatgggaatttatgttataaccaagatgctcatcggcaacgaatagttaattggatc
aatgccacgggtggcacttcctctgcattcgatgttaccaccaagggaatactgcattct
gcacttcataaccaatattggaggatgatagacccacaaggaaaaccaacaggagtagtg
gggtggtggccttcccgtgctgtcactttcttggaaaaccatgacactggctcaacacag
ggacactggccatttccacgtgataaacttgctcaaggatatgcatacatcttgactcat
cctggaacgcctacaattttctacgaccacttttatgattttgggattcgtgaaatgatc
aatgagttaattgaggctcgacaacgtgctgggatccattgtcgaagctcggttaagata
taccatgcgaacaatgaaggatatgttgcacaggttggagatactctggtaatgaagctt
ggacattttgattggaatccctcaaaggaaaatcatttggatgggaactggcaaaagttt
gttgacaaaggatcagattaccaactgtggctgagacaatag

DBGET integrated database retrieval system