KEGG   Cucumis melo (muskmelon): 103496445Help
Entry
103496445         CDS       T03195                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase SDP6, mitochondrial
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
cmo  Cucumis melo (muskmelon)
Pathway
cmo00564  Glycerophospholipid metabolism
cmo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cmo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    103496445
Enzymes [BR:cmo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     103496445
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 Pyr_redox FAD_binding_3 Pyr_redox_3 GIDA Lycopene_cycl NAD_binding_8 HI0933_like
Motif
Other DBs
NCBI-GeneID: 103496445
NCBI-ProteinID: XP_008456517
UniProt: A0A1S3C4P9
LinkDB All DBs
Position
Un
AA seq 629 aa AA seqDB search
MATATRLSKLAVAAVATAAGGSILLQPSLSSNDRGTSGHALESYRNKINDPSAVVPPRSV
QESALIGASPVNPLDILVVGGGATGCGVALDAVTRGLRVGLVEREDFSSGTSSRSTKLIH
GGVRYLEKAVFNLDYKQLKLVFHALEERKQFIENAPHLCHALPCMTPCFDWFEVIYYWIG
LKMYDLVAGRRLLHLSRYYSAQESVELFPTLARNGGGRSLKGTVVYYDGQMNDSRVNVGL
ACTAALAGAAVLNHAEVVGFLKDEASDRIIGARIRDKLSGREFDTYAKVIVNAAGPFCDS
VRKMADKEAVSMICPSSGVHIVLPDYYSPEGMGLIVPKTKDGRVVFMLPWLGRTVAGTTD
SNTGITMLPEPHEDEIQFILDAISDYLNVKVRRTDVLSAWSGIRPLAIDPSAKNTESISR
DHVVCEDYPGLVTITGGKWTTYRSMAEDAVSAAIKSGKLKPTNECVTDKLQLAGGDGWEP
AYFTVLAQQYLRMKKTHNGKVVPGVMDTAAARHLSQAYGVLAERVAAIAQNESLGKRLAH
GYPFLEAEVAYCARHEYCESAVDFIARRSRLAFLDTDAANHALPRVIEILAAEHKWDRSR
QKQELEKAKKFLETFKSSKNAQFHDGKHN
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgccacacggctgagcaagctcgccgtcgccgccgtagccaccgcagccggt
ggctcaatcctacttcaaccttctctctcctccaatgaccgtggcaccagtggtcacgcg
cttgagtcctacagaaacaagatcaatgatccgtctgcagtcgttccaccgcgatcagtt
caggagtctgctttgatcggagccagtcccgtcaatccgcttgacattctcgtcgtcggc
ggaggtgctaccggctgtggagtcgctcttgatgccgtcacaagagggcttcgcgttggt
ctcgtcgagcgcgaggatttctcgtccggcacgtcttcgcgctctacgaagctcattcat
ggaggcgtgcggtatttggagaaagcagtgttcaatttggattataagcagcttaaactg
gtgtttcatgcgcttgaggaacgaaaacagtttattgaaaatgcaccgcacttatgccat
gcgttgccctgcatgacaccttgttttgactggttcgaggtcatctactattggattggg
ttgaagatgtacgatcttgttgcagggcgtcgtctcttgcacttatctcggtactattct
gctcaggagtctgtggagctcttccctacccttgctaggaatggtgggggcaggagtttg
aaaggcactgtggtgtattacgatgggcagatgaatgactcgcgggtcaatgtagggctg
gcttgtactgccgctctcgctggcgcagcggtgcttaaccatgctgaagttgtgggattt
ttgaaggatgaggcgagtgatcgaattattggtgctagaattcgtgacaagttgtcaggt
agagagtttgatacctatgcaaaggtgattgtcaatgctgctgggccattttgtgactca
gttagaaagatggctgataaagaggcagtgtctatgatctgtcctagcagtggtgtccat
atagttctacctgattattattctcctgaaggaatgggtctaattgttcccaagactaag
gatgggcgtgttgtgtttatgcttccatggttaggacgaacagttgctggaaccacagat
tccaacacaggcatcacgatgcttcctgagccacatgaggatgaaattcagtttatactg
gatgcaatctctgattaccttaacgtgaaggtgaggcgaacagatgttctctcagcatgg
agtggtattcgtcctttggctattgatccatcggctaaaaatacagagagcatctcaaga
gatcatgttgtatgtgaagattatcctggattggtcacaatcaccggtgggaaatggact
acttatcggagcatggcggaggatgcagttagtgcggctataaagtctggcaagctgaag
ccgacaaatgaatgtgtaactgataagctgcagcttgctggtggagatggatgggaacct
gcatatttcactgtcttagctcaacaatatttacgcatgaagaagacccataatggtaaa
gttgtccccggggttatggacactgcagctgctagacatttatctcaagcttatggcgtt
ttagctgagagagtggccgccatagcccagaatgagagtttggggaagcggttagcccat
ggctaccctttcttagaggcagaagttgcatactgtgcacgacacgagtactgtgaatct
gcagtggatttcattgccagaagatcaagactcgctttcctcgatacggacgctgctaac
cacgcattaccacgagtaatcgagatattggcagctgaacataaatgggataggtcaaga
cagaagcaagaactagagaaggccaagaaatttctagaaactttcaaatcttcaaagaat
gctcaattccatgatggaaaacacaactag

DBGET integrated database retrieval system