KEGG   Cucumis melo (muskmelon): 103497371Help
Entry
103497371         CDS       T03195                                 

Definition
(RefSeq) histone-lysine N-methyltransferase CLF
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
cmo  Cucumis melo (muskmelon)
Pathway
cmo00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:cmo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    103497371
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cmo03036]
    103497371
Enzymes [BR:cmo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     103497371
Chromosome and associated proteins [BR:cmo03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     103497371
   Polycomb group proteins
    PRC2-EZH2 complex
     103497371
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET preSET_CXC TCR
Motif
Other DBs
NCBI-GeneID: 103497371
NCBI-ProteinID: XP_008457756
UniProt: A0A1S3C6D8
LinkDB All DBs
Position
Un
AA seq 923 aa AA seqDB search
MASKASLPSPSADRSDMPDDTQLKPQGQDPTPKEILSVIEFLKKQVAGERCNSVQKRMEE
NKQKLAGITTHLLKSSTERRIRRLSDSDKGVDLLTKRQKDALDMQNGIDVSDGENDRSQE
DGHASSAVLLGSNVAVRNAVRPIKLPEVKRLPPYTTWIFLDRNQRMTEDQSVVGRRRIYY
GQSGGEALICSDSEEEVIDDEEEKRDFVESEDYILRMTMKEIGSSDLVLESLANCFSRSP
GEIKARYEVLTQGEKAIGYFNNRINEEISHIGSTLLDKDLDAALDSFDNLFCRRCLVFDC
RLHGCSQDLVFPAEKQPKCGTVGEENVPCGPLCYRSVLKSDKNGIGGSPLRSDLEEKHPI
SSDGPGAQISTKKKSSCKAGRRRAKSYQSESASSNAKNISESSESENGPRQDGNTIHQSP
PLNSKITAVGELRKRNSKRVAERVLICMQKRQKKMAASESESLASVGHCPNDMKLKSNSC
KENDDSSSSSRKNIRSPTPGRPRRRESLTQKCNKLEQNETLNNSLNEIITHLPADSCDDN
SRKEECVDENLWKQDLANDKSWKPIEKGLYEKGIEIFGRNSCLIARNLLNGMKTCWEIFQ
YMNYSENKNCSQVGDGSNSHLEGYTKGSNEVRRRSRFLRRRGRVRRLKYTWKSAAYHSIR
KRITERKDQPCRQYNPCGCQTACGKQCACLLNGTCCEKYCGCPKSCKNRFRGCHCAKSQC
RSRQCPCFAADRECDPDVCRNCWVSCGDGTLGVPNQRGDNYECRNMKLLLKQQQRVLLGR
SDISGWGAFLKNSVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQFVLDAY
RKGDKLKFANHSPDPNCYAKVIMVAGDHRVGIFAKERISAGEELFYDYRYEPDRAPAWAR
KPEASGSKKDDGAPSSGRAKKLA
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgaaggcttctttgccttcaccttcagcagatagatcggacatgcccgatgac
actcagctgaaaccacaaggacaagatcctactcctaaagaaatcttatcagtcattgaa
tttctaaagaagcaagtcgctggcgaacgttgtaactctgtacagaaaagaatggaggaa
aacaagcagaagttggctggcatcaccactcacttgttgaaatcatctacagaaagaagg
ataagaaggctaagtgattcagataagggggtggatctattgacgaagaggcagaaggat
gcacttgatatgcagaatggtatagatgtaagtgatggcgaaaatgaccgatctcaagaa
gatggccatgcatcttctgcagttcttcttggatctaatgttgcagtaagaaatgctgta
cgacctattaagcttcctgaagttaaaagattgcctccttatactacatggatatttttg
gacagaaatcagagaatgactgaagatcaatctgtggttggtcgaaggagaatttattat
ggtcaaagtggaggcgaagccctcatttgcagtgacagcgaggaagaagtaattgatgat
gaagaggaaaagagagattttgtggaatctgaagattatatacttcggatgactatgaaa
gaaattggttcatcagatctggtgctagagtcacttgccaattgtttctctagaagtccc
ggtgaaataaaggcaagatatgaagtgcttacccagggagaaaaggctatagggtatttc
aataataggatcaacgaggagatctcacatattggaagtactcttcttgataaagatctt
gatgcagctcttgattcttttgacaatctgttttgccgtcgttgtcttgtcttcgattgt
agactacatggttgctcccaagatcttgtttttcctgctgagaaacaacctaaatgcggc
accgtaggtgaggaaaatgtaccctgtggtccactctgctatcgatcagtactgaaatca
gacaaaaatggtatagggggttctccgcttcgcagtgacttggaagaaaaacatcccatt
tcatctgatggtcctggagctcaaatctccacaaagaagaaatcttcttgtaaagctggt
cgaagaagggcaaagtcctatcagagtgaaagtgcctcatcaaatgcaaagaacatatca
gaaagcagtgagtcagagaatggacccaggcaggatgggaatactattcatcaatcacct
ccactgaattctaagataacagcggtgggtgaacttcgaaaaaggaacagcaagcgtgtt
gctgagcgtgttctcatttgcatgcagaaacggcagaagaaaatggctgcttctgagtca
gaatctctagctagtgtaggtcattgtccaaatgacatgaaattaaaatctaactcatgt
aaagaaaacgatgatagtagctcctcttcacgtaagaatattagatctcctacacctgga
aggcctaggaggagggaatccctgactcagaaatgcaacaaacttgagcagaatgaaaca
ctcaataattcattaaatgagattattactcatctaccagccgacagttgtgatgacaac
tcaaggaaagaagagtgtgtggatgaaaatttatggaagcaggacttggcaaatgataaa
tcttggaagcctatagaaaaaggtctctatgagaagggcattgagatttttggtaggaac
agctgcttaatagcaaggaatttactaaatgggatgaagacctgttgggaaatttttcaa
tacatgaattactctgagaacaagaattgcagccaagtgggagatggatcaaattctcat
cttgaaggttacaccaagggtagtaatgaggtgagaagaaggtcgagattcttgcgtaga
aggggtagagtccgtcgactaaaatatacttggaaatcagctgcttaccattcaattcgg
aagcgaataactgaaaggaaagatcagccgtgcagacaatataatccatgtggttgccaa
actgcctgtggaaagcagtgtgcctgtcttttaaatggcacctgctgtgagaagtactgt
gggtgccctaagagttgcaagaatcgttttagaggatgccattgtgccaaaagtcaatgt
cgtagtcgtcaatgtccttgttttgcagcagatagagaatgtgatccagatgtctgtagg
aattgttgggtcagctgtggtgatggtactcttggggttcccaaccaaagaggtgataat
tatgagtgcaggaacatgaagcttcttctcaaacaacaacaaagagtgttactcggaaga
tcagatatatctggttggggagcatttctaaagaatagtgttggcaaacatgaatatctt
ggcgagtatactggggagttaatttcacatagggaggctgataagcgaggcaaaatatat
gatcgtgaaaactcgtcatttctgttcaatttgaatgaccagtttgttcttgatgcatac
cgaaagggtgataaactaaaatttgctaatcattctccagatccgaactgctacgccaag
gtcatcatggtggcaggagatcaccgggttggtatctttgccaaggaaagaatcagtgct
ggggaggaactcttttatgattatagatacgagcctgatcgagccccggcttgggctagg
aagcctgaggcatcgggatcaaaaaaggatgacggtgctccatcgagcggtcgagcgaag
aaacttgcttaa

DBGET integrated database retrieval system