KEGG   Cucumis melo (muskmelon): 103498289Help
Entry
103498289         CDS       T03195                                 

Definition
(RefSeq) alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
cmo  Cucumis melo (muskmelon)
Pathway
cmo00052  Galactose metabolism
cmo00500  Starch and sucrose metabolism
cmo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    103498289
   00500 Starch and sucrose metabolism
    103498289
Enzymes [BR:cmo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     103498289
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 BON
Motif
Other DBs
NCBI-GeneID: 103498289
NCBI-ProteinID: XP_008459069
UniProt: A0A1S3C8V0
LinkDB All DBs
Position
Un
AA seq 909 aa AA seqDB search
MASGSSKAITIRTPFAHSLLILILFLFTSFLIPPPAASLPAVGFGYRIRSSHIDPAGKSL
TADLQLIRTSQVYGPDLPTLTLQATFESKDRLRVRITDSTRERWEIPDHIIPRPSNSLIR
SLPENHVASPKPSFISDPASDLIFTLYDTAPFGFSVLRRSSGDVLFDTSPDFSNSETFIV
FKDQYIQLSSLLPKDRSSIFGIGEQTRKSFKLVPDKNKTLTLWNADIGSVNLDVNLYGAH
PFYIDVRSRSRDGKVVAGTTHGVLLLNSNGMDIIYSGDRITYKVIGGIIDLYFFAGPSPI
SVIDQYTELIGRPAPVPYWSFGFHQCRYGYKNVSEVESVVARYAKASIPLEVMWTDIDYM
DGYKDFTFDPINFPSEKMKIFVDNLHKNGQKYVIILDPGISTNNTYGPYIRGTKADIFMK
HDGVPYLGDVWPGPVYFPDFLHPDSETFWGREIQIFRDIVPFDGLWIDMNEISNFITSST
SPLSNLDNPPYMINNARVRRPLNNKTVPASILHFGNLTEYNTHNLYGFLESRATHASLVK
VTGKRPFVLSRSTFAGSGKYTAHWTGDIGATWNDMGYTIPSILNFGLFGIPMVGSDICGF
SGDTTEELCRRWIQLGAFYPFARDHSDKGSIRQELYLWDSVAASARKVLALRYQLLPYFY
TLMYEAHKKGTPIARPLFFSFPQDIKTYEIDSQFLLGEGVLVSPVLKEGAFSVDAYFPAG
NWFSLFNYSEFVAVNSGQQINLDAPADHINVHVREGNILALHGEAMTTQAARETAYKLLV
VISNGQRSFGEVFLDDGEVAEMGGEGGNWSMVRFCSETVGSKLVVKSQVINGGFALSQKL
IIDKVTFVGFERPKKMVGLGLNISKGVSLNGNSSIRKTYQYFAKFMNVEISGLSIPIWEE
FILEMTPIS
NT seq 2730 nt NT seq  +upstreamnt  +downstreamnt
atggcgagtggttcgtccaaagccataaccataaggacgccatttgctcattctctccta
atactaatactctttcttttcacttccttcctgatccctccaccggctgcttctctacca
gccgtcggatttggataccggatcagatccagccacatcgatcctgccggaaagtcattg
accgccgatcttcaactcatccgaacctcccaagtctatggacctgatcttcccacactt
accctccaagccactttcgaaagcaaagaccggttgagagtacgaataacggactcaact
cgtgaacggtgggagattccagaccatatcattccccgtccatccaactcccttatccgt
tccctgccggaaaaccatgtcgcctccccgaaaccttctttcatctccgatccagcttcc
gacctcattttcaccctctacgacactgcacccttcggcttttccgtgctccgacgatca
tccggtgatgtcctctttgacacttcccctgatttctccaattccgagacttttattgtc
ttcaaggatcaatacattcaactatcctctttgcttccgaaggacagatcctctatcttt
ggcattggcgagcaaaccaggaagtctttcaagctcgtcccggataaaaacaaaacctta
actctttggaacgctgatattggtagtgtgaatctcgatgtgaacctctacggtgcacat
cctttctacattgatgtccggtcgcggtctcgagatggtaaagttgtagcagggacgacg
catggagttttgttgctcaacagtaatggcatggatattatatattctggcgataggatt
acgtacaaggttattggtggaatcattgatttatacttctttgcaggtccatcaccaatt
tcggtgatagatcagtatactgagcttattgggcggcctgcacctgtgccttattggtcg
tttggttttcatcaatgtcgttatggctacaagaatgtttctgaggttgaaagtgtagtg
gctcgttatgccaaagccagtatacctcttgaagttatgtggacagacattgattacatg
gatgggtataaagactttacttttgatcccatcaattttccatcggagaagatgaagata
tttgttgataatcttcacaaaaatggacaaaaatatgtaatcatcttggatcctggcatt
agtacaaataatacatatggaccatacattcgaggaacaaaagctgatatctttatgaaa
cacgacggggttccatacttgggtgatgtttggcctggacctgtttactttcctgatttt
cttcatccagacagtgagactttttggggtcgtgagatccaaatatttcgagatattgtt
ccatttgatggtctttggatcgatatgaatgagatatcaaattttataacttcttcaacc
agcccactttctaaccttgataatcctccttacatgattaacaatgctagagttcgacgt
ccccttaacaataagactgtgccagcgtcaattcttcattttggtaacttgacagagtat
aatactcataacttatacgggtttttagagtcaagggctactcatgcctcattagtaaaa
gtaacaggcaagagaccatttgtgctgtcaagatcaacttttgcaggctctgggaagtac
acagcacattggactggagatattggcgcaacatggaatgatatggggtacacgattcca
tccattttgaactttggactcttcggaattcctatggttggttctgacatatgtggattt
tctggagatacgacagaagagctttgccgacgttggattcagttaggtgcattttaccca
tttgccagagaccattctgataaaggatccattcgtcaagagctttatctttgggattca
gtggctgcatcagccaggaaggtgcttgcgcttcgctaccagttacttccttatttctac
actttgatgtatgaggcacacaaaaaggggacaccgattgcacgtcctctcttcttctca
ttccctcaggatatcaagacctacgaaatcgactctcagtttcttcttggagaaggtgta
ttggtttctccagttctaaaggagggagctttttctgttgatgcatatttccctgcagga
aactggtttagcctctttaactattcagagttcgtagctgtaaattccgggcaacaaatc
aatcttgatgcacctgctgatcatataaatgtgcacgtcagggaaggaaacattctggca
ttacacggagaggcgatgacaacacaagcagctcgagaaactgcatacaagcttttggtc
gtcatcagcaatggtcaaagaagctttggagaggttttcttggatgatggagaagtggcg
gaaatgggaggagaaggaggtaattggagtatggtaagattttgtagtgaaacagttggg
agtaagttagtagtgaaatctcaggttataaatggaggatttgctttgagccaaaaactg
attatagacaaggtgacctttgtaggctttgaaaggcctaagaaaatggttggcctaggc
ttaaatataagcaagggagtgagtttgaatggaaattcaagcattagaaaaacctatcaa
tattttgccaagtttatgaatgttgagatctcagggctatccattcctatttgggaggaa
ttcatattggagatgacaccaataagttga

DBGET integrated database retrieval system