KEGG   Cucumis melo (muskmelon): 103500643Help
Entry
103500643         CDS       T03195                                 

Definition
(RefSeq) alanine aminotransferase 1, mitochondrial
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
cmo  Cucumis melo (muskmelon)
Pathway
cmo00220  Arginine biosynthesis
cmo00250  Alanine, aspartate and glutamate metabolism
cmo00710  Carbon fixation in photosynthetic organisms
cmo01100  Metabolic pathways
cmo01200  Carbon metabolism
cmo01210  2-Oxocarboxylic acid metabolism
cmo01230  Biosynthesis of amino acids
Module
cmo_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:cmo00001]
 Metabolism
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    103500643
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    103500643
   00220 Arginine biosynthesis
    103500643
Enzymes [BR:cmo01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     103500643
Amino acid related enzymes [BR:cmo01007]
 Aminotransferase (transaminase)
  Class I
   103500643
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 103500643
NCBI-ProteinID: XP_008462239
UniProt: A0A1S3CGI8
LinkDB All DBs
Position
Un
AA seq 488 aa AA seqDB search
MAPTSNDSLPVSIHNINPKVLKCEYAVRGEIVALAQKIQEELLTNPGSRPFEEILYCNIG
NPQSLGQQPITFFREVLALCDHPSILERKEVEGLFSEDAIKRASEILKQIPGKATGAYSH
SQGIKGLRDAIAEGINARDGFPADPNDIFLTDGASPAVHMMMQLLITSEKDGILCPIPQY
PLYSASIALHGGTLVPYYLDEASGWGLEISELKKQLESAKSKGISVRALVVINPGNPTGQ
VLTKENQEQIVKFCKQEGLVLLADEVYQENIYVPDKKFHSFKKISRTMGYGEKDISLVSF
QSVSKGYYGECGKRGGYMEITGFSADVREQIYKVASVNLCSNITGQILASLVMNPPKDGD
LIYKSYCAERDGILSSLARRAKMLEAALNSLENVTCNKAEGAMYLFPCIKLPVKAIKAAE
AANTAPDTFYCRQLLNATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAVISRLTDFHK
AFMNEYRD
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggcacctacttccaacgattcccttccggtttccattcacaacatcaatccgaaggtt
ctgaaatgtgagtatgctgtccgtggtgagattgtcgctcttgctcagaaaatacaagaa
gagctattgactaatccaggctcacgtccttttgaagagatactatactgcaatatagga
aatcctcagtcacttggtcagcagccaataacatttttccgcgaggttcttgcgttgtgt
gaccatccatctattctggaaagaaaggaagtagagggtttgttcagtgaagatgctatt
aagcgagcttcagaaattctaaaacaaattcctgggaaagctactggtgcttacagccac
agtcagggaattaaggggctacgtgatgcgattgctgaaggaattaatgctcgtgatggt
tttccagcagatcctaatgatatatttttaacagatggtgcaagcccagcggtccatatg
atgatgcaattgttgataacttcagagaaagatggaatactctgccccattcctcagtac
cctctgtactctgcttctatagctcttcatgggggtactcttgttccttactatcttgat
gaagcatcggggtggggattggaaatttctgagctgaagaagcaattggagtctgccaag
tctaagggtatttcagttagagcattggtggttataaatccgggcaatcctactgggcag
gttctcactaaggaaaaccaagagcagatagtgaagttctgcaagcaagagggccttgtt
cttttggcagatgaggtatatcaggaaaatatctacgttccagacaagaagttccactct
tttaagaagatttcacgcaccatgggttatggtgaaaaggacatttccttggtatcattt
cagtctgtctcaaaaggatattatggtgaatgtggaaaacggggaggttacatggagatt
actgggtttagtgctgatgtgagggaacagatatacaaagtggcatctgttaatctttgt
tctaatattaccggccagattcttgctagccttgtaatgaatccaccaaaggatggggat
ctcatctataaatcgtattgtgcggagagagatggaattctctcatctttggcaaggcgt
gcaaagatgttagaagctgcactcaacagtttagaaaatgttacgtgcaataaagcagaa
ggcgcaatgtacctattcccctgtattaagctgcctgtaaaggcaatcaaagcagcagaa
gcagcgaacacggcccctgatacattctattgccgccaacttctcaatgccactggaata
gttgttgtccctggttccggctttggtcaggtccccggtacatggcacttcaggtgtaca
atactaccccaagaggacaagatcccagctgtcatctctcgcctgaccgacttccataaa
gcattcatgaacgaatatcgcgactga

DBGET integrated database retrieval system