KEGG   Cucumis melo (muskmelon): 103501361Help
Entry
103501361         CDS       T03195                                 

Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
cmo  Cucumis melo (muskmelon)
Pathway
cmo00250  Alanine, aspartate and glutamate metabolism
cmo00410  beta-Alanine metabolism
cmo00430  Taurine and hypotaurine metabolism
cmo00650  Butanoate metabolism
cmo01100  Metabolic pathways
cmo01110  Biosynthesis of secondary metabolites
Module
cmo_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:cmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    103501361
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    103501361
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    103501361
   00430 Taurine and hypotaurine metabolism
    103501361
Enzymes [BR:cmo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     103501361
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 103501361
NCBI-ProteinID: XP_008463152
UniProt: A0A1S3CIY3
LinkDB All DBs
Position
Un
AA seq 499 aa AA seqDB search
MVLSKTASQTDVSVHSTFASRYVRTSLPRFKMPENSIPKEAAFQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIMSAINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLGDSETAVG
VGTVGSSEAIMLAGLAFKRKWQNRRKAEGKPYDKPNIVTGANVQVCWEKFARYFEVELKE
VKLREGYYVMDPEKAVEMVDENTICVAAILGSTLNGEFEDVKLLNDLLVEKNKETGWDTP
IHVDAASGGFIAPFIYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRNKEDLPEEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGYEGYQNVMENCRENMIVLKEGLER
TGRFNIVSKDNGVPLVAFSLKDNTRHTEFEVSEMLRRFGWIVPAYTMPPDAQHITVLRVV
IREDFSRTLAERLVNDIEKTLHELDSLPSKADMKTTVAGEETQKNNVVVAKKSALETQRE
ITTAWRKFVMEKKKTNGVC
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggttctctccaaaaccgcttctcagaccgatgtctccgtccattccaccttcgcttcc
agatatgtccgaacctctctcccaagattcaaaatgccggaaaattcgatccccaaggag
gctgcgtttcagatcattaatgatgaactcatgctcgatggaaaccctaggttaaatttg
gcgtcctttgttactacctggatggagcctgagtgtgataaactcatcatgtctgccatc
aacaagaattacgttgatatggatgaatatcctgtcaccacagagcttcagaaccgatgt
gtgaatatgatagcacatttgttcaatgccccattgggtgattctgaaacggcagtggga
gttggaacagtgggatcgtcagaggccataatgttggctggtttggctttcaagagaaaa
tggcagaacagaaggaaggctgaaggcaagccctatgacaagcccaacattgtcactggt
gctaatgtccaggtatgctgggagaaatttgcaagatacttcgaagtagaactcaaggag
gtgaaattgagggaaggttactatgtgatggatccagagaaagctgtagagatggttgat
gagaacacaatctgtgttgcagccatcttgggttccactctcaatggagaattcgaagat
gtaaaactcttaaacgatctcttagtcgagaagaacaaagaaactggatgggatactcct
attcatgttgatgctgcgagtggagggtttattgctccattcatttaccctgagctagaa
tgggactttaggttgccacttgtaaagagtattaatgtgagtggccataagtatgggctt
gtgtatgctggaattggttgggttatctggaggaacaaagaagatttgcctgaagaactt
atctttcatatcaactatcttggagctgaccaacccactttcaccctcaatttctccaaa
ggatctagtcaagtcattgctcagtattaccaattgatccgtttgggttatgagggatac
caaaacgtgatggaaaactgcagagaaaacatgattgtcctaaaggaaggactcgagaga
acagggcggttcaacatcgtgtcgaaggacaatggagttccacttgtggccttctccttg
aaagacaacacacgccatacggagtttgaggtatcagaaatgctgaggagattcgggtgg
attgtaccagcttacaccatgcctccggatgcacaacacataactgtccttagagtcgtg
atccgagaagatttttctcgcacgcttgctgagcgtcttgtgaatgatattgagaaaaca
ttgcacgaactcgatagcctcccatcgaaggctgatatgaagacaacggtggctggagaa
gagacgcagaagaacaatgttgtggtggcgaagaagagtgctcttgagacacagagggag
atcacaactgcttggaggaagtttgtgatggaaaagaagaagacgaatggagtttgttag

DBGET integrated database retrieval system