KEGG   Cucumis melo (muskmelon): 103501810Help
Entry
103501810         CDS       T03195                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase, housekeeping isozyme
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cmo  Cucumis melo (muskmelon)
Pathway
cmo00620  Pyruvate metabolism
cmo00710  Carbon fixation in photosynthetic organisms
cmo01100  Metabolic pathways
cmo01200  Carbon metabolism
Module
cmo_M00168  CAM (Crassulacean acid metabolism), dark
cmo_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
cmo_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
cmo_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:cmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    103501810
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    103501810
Enzymes [BR:cmo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     103501810
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2 E2R135
Motif
Other DBs
NCBI-GeneID: 103501810
NCBI-ProteinID: XP_008463734
UniProt: A0A1S3CKE8
LinkDB All DBs
Position
Un
AA seq 965 aa AA seqDB search
MANRNLEKMASIDAQLRLLVPARVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEC
YELSAEYEGKHNPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIK
LKKGDFADENSATTESDIEETLKKLVGELKKSPQEVFDALKNQTVDLVLTAHPTQSVRRS
LLQKHARIRDCLVQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM
SYFHETIWKGVPKFLRRVDTALKNIGIDERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR
DVCLLARMMAANLYYSQIEDLMFELSMWRCSNELRERADMLHNSSRRDAKHYIEFWKQVP
ASEPYRVILGDVRDKLYQTRERSRHLLANGYSDIPEDATFTNVEQFLEPLELCYRSLCAC
GDRAIADGTLLDFLRQVSTFGLSLVRLDIRQESDRHTDVLDAITQHLDIGSYKEWSEEQR
QEWLLSELSGKRPLFGPDLPTTEEISDVLNTFHVIAELPSDNFGAYIISMATAPSDVLAV
ELLQRECHVSQPLRVVPLFEKLADLEAAPAALARLFSIDWYRNRINGKQEVMIGYSDSGK
DAGRFSAAWQLYKAQEELIKVAKQYGVKLTMFHGRGGTVGRGGGPTHLAILSQPPETVHG
SLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMHPPVSPKPEWRALMDEMAVVATE
EYRSIVFKEPRFVEYFRLATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTRF
HLPVWLGFGAAFKHIIQKNVKNLQMLQEMYNEWPFFRVTIDLVEMVFAKGDPGIAALYDK
LLVSEDLWSFGERLRANYEETKSLLLQIAGHRDLLEGDPYLKQRLRLRDSYITTLNVCQA
YTLKRIRDPNYDVKVRPHISREIMEASKPADELVHLNPKSEYAPGLEDTLILTMKGIAAG
MQNTG
NT seq 2898 nt NT seq  +upstreamnt  +downstreamnt
atggctaaccggaatctggaaaagatggcatcaattgatgcgcagcttcggcttttagta
ccagccagagtgagtgaggatgataaattggtggagtacgatgcgttgttactggatcgg
ttccttgacattctccaggatttacatggagaggatctgaaggaaactgtgcaagagtgt
tatgaactttctgccgaatatgaaggaaagcacaatccaaagaaactcgaagagcttgga
aatgtgctgactagtttagatccaggggactctattgtcattgccaaatctttctcgcat
atgcttaacttagctaacttggctgaggaggttcagattgcttatcgtcgaaggatcaaa
ctgaagaagggagattttgctgatgaaaactcagcaaccactgaatctgacattgaggaa
actctgaagaagcttgtaggggaactgaaaaagtcccctcaagaagtttttgatgccttg
aagaaccagactgttgatttggtcttaactgctcatcctactcaatcagttcgtagatct
ttgcttcaaaagcatgcaagaataagggattgtttagtccagttgtatgccaaagatatc
actccagatgacaagcaagagctggatgaggcacttcagagagagattcaagctgcattt
cgtactgatgaaatccgtagaactcctcctaccccacaagatgaaatgagggcaggaatg
agctacttccatgagacaatttggaagggtgttcctaaatttctgcgtcgtgttgatact
gctttgaaaaacatagggattgatgaacgtgttccttataatgcaccactaattcagttt
tcatcttggatgggtggtgatcgcgatggtaatcctagggtgacacctgaggttacaagg
gatgtctgtcttcttgctagaatgatggctgctaatctttactactcacagattgaggat
cttatgtttgagttgtctatgtggcgttgcagtaacgagcttcgtgagcgtgcagacatg
cttcataattcatcgaggagggatgcaaaacactatatagagttttggaagcaagttcct
gccagcgaaccttaccgagtgattcttggtgatgtaagggacaagctttatcagacacgt
gaacgttcccgccatttgttagctaatggatattctgacatcccagaggatgcgactttt
acaaatgttgagcagttcttggagcctcttgaactatgctaccgatccctctgtgcatgt
ggtgaccgtgcaattgctgatggcacccttcttgattttttgaggcaagtgtccactttt
ggcttgtcacttgtaagacttgacatcaggcaagagtctgatcgtcacaccgatgtcttg
gatgccattactcagcatttggatattggttcctacaaagaatggtctgaggaacagcga
caagaatggcttttatctgaactcagtggcaaacgtcctctttttggtcctgatcttcct
acaacagaagaaatatctgatgttttgaacacattccatgtcatagctgaacttccttct
gataacttcggtgcatatatcatttccatggccactgctccatctgacgttttggccgtt
gagctcttgcagcgtgagtgccatgttagccaaccattgagagttgttcccttgtttgaa
aagcttgcagatttggaggctgcgcctgcagcccttgctcgcctcttctcgatagattgg
tacagaaatcggattaatggaaagcaagaagtcatgattggctactctgattctggcaaa
gatgctgggcggttctctgcagcctggcagttatacaaggctcaagaggagcttataaag
gttgcaaaacaatatggtgtaaaactaactatgtttcatggtcgtggtggcactgttgga
agaggaggtggacccactcatcttgctattttgtcccaaccacccgagacagttcacggt
tcactccgtgtaacagtacaaggggaagttattgagcagtcctttggagaggagcacttg
tgttttagaacacttcaacgtttcactgcggcaacgctcgagcatggtatgcaccctcca
gtttcaccaaaacctgaatggcgtgcgctgatggatgaaatggccgttgttgctacagaa
gaataccgttccattgtcttcaaagaaccacgatttgtcgaatatttccgcctggcaaca
ccagaactggaatacggtaggatgaatattggaagccgtccatcaaagcggaagccaagt
ggtggtatcgagtcactccgtgcaatcccatggatctttgcatggacacagacgagattc
catctaccagtttggttaggcttcggagcagcattcaagcatattattcagaaaaatgtc
aagaaccttcaaatgctgcaggagatgtacaacgaatggcccttctttagggtcaccatt
gatttggttgaaatggtgttcgctaaaggagaccctggaattgctgctttgtacgataag
ctcttggtctcagaagacctctggtcgttcggagagcgcttgagagccaactatgaagaa
acaaagagccttttgctgcagattgctggacacagagatcttcttgaaggggatccttac
ttgaagcaaagacttcgtctccgtgattcatacatcacgactctgaacgtgtgtcaagcc
tacacactgaaacgaattcgtgatccaaactacgacgtgaaagttcgaccacacatttca
agggaaataatggaagcaagcaaaccagcagatgaactcgttcatctaaacccgaaaagt
gaatacgcacctgggctagaggacaccctgatcttgaccatgaagggcattgctgctgga
atgcagaacactggttaa

DBGET integrated database retrieval system