KEGG   Cucumis melo (muskmelon): 103502003Help
Entry
103502003         CDS       T03195                                 

Definition
(RefSeq) beta-galactosidase 17
  KO
K12309  beta-galactosidase [EC:3.2.1.23]
Organism
cmo  Cucumis melo (muskmelon)
Pathway
cmo00052  Galactose metabolism
cmo00511  Other glycan degradation
cmo00531  Glycosaminoglycan degradation
cmo00600  Sphingolipid metabolism
cmo00604  Glycosphingolipid biosynthesis - ganglio series
cmo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    103502003
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    103502003
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    103502003
   00604 Glycosphingolipid biosynthesis - ganglio series
    103502003
   00511 Other glycan degradation
    103502003
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cmo04147]
    103502003
Enzymes [BR:cmo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     103502003
Exosome [BR:cmo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103502003
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_35 Glyco_hydro_42 BetaGal_dom4_5
Motif
Other DBs
NCBI-GeneID: 103502003
NCBI-ProteinID: XP_008464017
UniProt: A0A1S3CKJ1
LinkDB All DBs
Position
Un
AA seq 719 aa AA seqDB search
MNCSSKLSSMAKRRHLIPSFFFLLLIFLTVLGVIVPVFALLPSLHSHSQGLFRHHHDRSN
FNKVHTRKFEIDDDMFWKDGKPFQIIGGDLHYFRTLPEYWEDRLLRAKALGLNTIQTYIP
WNLHEPKPGNFTFNGIANIVSFIQLCQKLDFLVLLRPGPYICAEWDLGGFPAWLLSKIPA
SRLRSSDPGYLQWVERWWGVILPKVAPLLYNNGGPIIMVQIENEFGSYGDDQAYLHHLVA
LARGYLGDEIILYTTDGGTRETLEKGTIRGNAVFSAVDFSTGERPWPIFNLQKEFNPPGK
SPPLTAEFYTGWLTHWGENIATTDANTTAAALNEILAGKGSAVLYMAHGGTNFGFYNGAN
TGNDVLDYKPDLTSYDYDAPIKESGDVDNAKYEAIRRVIQHYSGALIPSVPSNNEKIGYG
PIQLQKVAFLFDLIHMMDPVDVAVSEEPLSMESTDRSFGFLLYTTEYVAKDNDDGHVLFI
PEVHDRAQVFLSCSSKNKGVRPTSVGIIERWSNRRLNLPNTRCDSNTLSILVENMGRINY
GRYLFDRKGILSSVYLDNNVLHGWKMIPLPFNNLNEIPRVDFFSQIAQSRLSKIIAKRGL
EAKFGNISGEPTLYSGYFYVDEANLRKDTYLSFGGWTKGIAFINEFNLGRFWPVVGPQCN
LYVPAPILRLGKNILVILELESPNRDTVVHSVDRPDFTCGSSKSNLSQQLLSHQHSVGL
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgaattgtagttcgaagctttcatccatggcgaagagacggcacctgataccttctttt
ttcttcctcctcctcatcttccttacagttcttggagtgatcgttccagtctttgctctt
cttccttcattacattctcactcccaaggtctcttccgccatcaccatgatcgttccaac
ttcaacaaggttcatactagaaagtttgagattgatgatgacatgttctggaaagatggt
aaaccatttcagattattggtggtgacctgcattatttcagaactcttcctgagtactgg
gaagatagactgcttagagcaaaggcattgggattaaacacgatccaaacttacattccc
tggaatctgcatgagccaaaacctggaaatttcacatttaatgggattgcaaacatagtg
tcgtttatccaactctgtcagaagctagattttctagttttgctccggccagggccttat
atatgtgcagagtgggaccttgggggttttcctgcttggttgcttagcaaaataccagct
tctaggctaagatcctcagatcctggttacctccaatgggttgaacgatggtggggggtt
attcttccaaaagtagctccccttctttacaataatggaggccctataataatggtccag
attgaaaatgaatttggttcatatggagacgatcaagcttaccttcaccatttggttgcg
ttggcaagaggttaccttggggatgaaataatattgtatactacggatggaggtactagg
gaaactcttgagaaaggaaccattcgtggcaatgccgtgttttcggctgttgacttttca
accggtgaaagaccttggcctatttttaatttacagaaggagttcaaccctcctggaaaa
tctccacctcttactgcagagttctacacgggctggcttacacattggggagaaaatatt
gcaacaactgatgccaacactacagcagctgccttgaatgaaatattggcagggaaaggg
tctgctgtgctttatatggctcatggtggaacaaattttggattctataatggagcaaat
actggtaatgatgtattggattacaagcctgatctcacttcgtatgattatgatgcacca
attaaggaatctggtgacgttgacaatgctaaatatgaagcaattcgaagggttatacag
cactacagcggagcgctgattccttccgttccttctaacaatgaaaagataggttatgga
ccaattcagttgcagaaagttgcatttttgtttgatctaatccatatgatggatccagtt
gatgtggctgtgtctgaagaaccactgtcaatggaatctacggatcggagctttggattt
ttgttatatacgaccgaatatgtggccaaggataatgatgatggacacgttttatttata
ccagaggtgcatgatcgagcacaagtgttcctctcttgctcttctaaaaacaagggtgta
cggccaacttcggttggcattattgaaagatggtcaaaccggcggcttaatctaccaaat
acgagatgtgactcaaatactttatccattttggttgaaaacatgggtcgcataaactat
ggacgctacttatttgacaggaagggtatcttatcatctgtttacttggacaacaatgtt
ctacatggatggaaaatgattccattgcctttcaacaacctgaatgaaattccaagagtc
gatttcttctctcaaattgcacaatctagactcagcaaaatcatagcaaagagaggctta
gaagccaagtttggtaacatctccggcgaaccgacactatacagtggttacttttatgtc
gacgaagcgaacctcagaaaagatacgtacttatcatttggtggttggactaaaggaatt
gcattcattaacgaatttaatcttggaagattttggccggttgtagggccacaatgcaac
ctatatgttcctgctccaattcttcggcttgggaagaatatactggtcatactcgagtta
gaatctccaaatcgtgatactgttgtacattctgttgatcggccagacttcacttgtggt
tcttccaagtccaacttatctcagcagcttttaagccaccaacattctgtgggcctttga

DBGET integrated database retrieval system