KEGG   Cucumis melo (muskmelon): 103503033Help
Entry
103503033         CDS       T03195                                 

Definition
(RefSeq) DNA ligase 1-like
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
cmo  Cucumis melo (muskmelon)
Pathway
cmo03030  DNA replication
cmo03410  Base excision repair
cmo03420  Nucleotide excision repair
cmo03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:cmo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    103503033
   03410 Base excision repair
    103503033
   03420 Nucleotide excision repair
    103503033
   03430 Mismatch repair
    103503033
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cmo03032]
    103503033
   03400 DNA repair and recombination proteins [BR:cmo03400]
    103503033
Enzymes [BR:cmo01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     103503033
    6.5.1.6  DNA ligase (ATP or NAD+)
     103503033
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     103503033
DNA replication proteins [BR:cmo03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    103503033
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     103503033
DNA repair and recombination proteins [BR:cmo03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     103503033
   NER (nucleotide excision repair)
    Other NER factors
     103503033
   MMR (mismatch excision repair)
    Other MMR factors
     103503033
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase DUF5562
Motif
Other DBs
NCBI-GeneID: 103503033
NCBI-ProteinID: XP_008465403
UniProt: A0A1S3CNQ9
LinkDB All DBs
Position
Un
AA seq 801 aa AA seqDB search
MLSLRSCFYLRPITLPHPQFKKLIFSNNPSFSFKPISQNLVSPMSSRPSAFDALMSGARA
AAKKKPANSSPKKRKALDSLDPPLKPSSVLALESTPPVESQCGSSIPNLDDHGGTHLDVV
DLGETKLGQDNGGGVGAKIGPFGNKTCASSVQERTAKLKSSIAELKKKAKDFNSKNVACW
KEGERVPFXFLCLGFDMISEESSRITITDIVCNMLRTVMDTTPDDLVATVYLLANKIAPA
HEGLELGIGDASIIKALSEAFGRTEAQVKKQYKELGDLGLVAKASRSSQSMMRKPDALTI
AKVFDTFRLIAKESGKDSQEKKKNHIKSLLVAATDCEPLYLIRLLQTKLRIGLAEQTLLA
ALGQAAVYAEKHSTPPPNIQSPLEEASKIVKQVFSILPVYDKLVPALLSGGVWNLSKACN
FTPGIPIGPMLAKPTKGVSEILNKFQGLEFTCEYKYDGERAQIHYMEDGSVEIYSRNAER
NTGKFPDVVLTVSRIKKPSVRSFILDCELVAYDRGKQKILPFQILSTRARKNVAVSDIKV
EVCVFAFDLLYLDGQPLIQRELNARRELLYDSFIEESGYFQFATAIITNDLEEIQKFLDA
SVDQSCEGLIIKTLNRDATYEPSKRSHNWLKLKKDYIDSIGDSLDLVPIAAFHGRGKRTG
VYGAFLLACYDNDNEEFQSICKIGTGFSEAMLEERSASLRSKVIPQPKSYYRYGDAINPD
VWFEPTEVWEVKAADLTISPVYRAGVGIVDSDKGISLRFPRLVRVRKDKYPEEASSSEQV
ADMYNAQKHNHQNNQDDNEDD
NT seq 2406 nt NT seq  +upstreamnt  +downstreamnt
atgctttctctgcgttcatgtttctatctacgccccatcacattgcctcatccccaattc
aagaaactcattttctccaacaatccttccttctctttcaaacccatatctcagaatttg
gtttcaccaatgtcttctcgtccttccgccttcgatgctcttatgtctggtgctcgtgcc
gctgccaagaagaagcctgctaattcttctcccaagaagcgtaaagcccttgattcatta
gatcctcctctgaaacctagctctgtccttgctcttgagtcaacgccgcctgttgaatcg
cagtgcggcagttcaattccaaatttggacgatcatggaggtactcatttggatgttgtc
gatttgggagaaacaaagctgggtcaggataatggtggcggtgttggagccaagattggg
ccgtttgggaacaagacttgtgcgtctagtgttcaagaaagaacagcgaaattgaagagc
tctattgcagaattgaaaaagaaggctaaggatttcaactcgaagaatgttgcttgttgg
aaagagggtgaacgtgttccttttntgtttctttgtttgggtttcgatatgatttcggag
gagtccagtaggattactatcaccgatatagtctgcaacatgctgaggaccgtcatggat
actacacccgacgacttggtagccactgtgtatcttttggcgaataagattgctccagct
catgaagggcttgagttggggattggggatgcttctattatcaaagctctttctgaggca
tttgggaggacagaggcacaggtcaaaaaacagtacaaggaattgggagatttgggtctt
gttgctaaagcaagccgttcatctcaatctatgatgcgaaagcccgatgctttaactatt
gccaaagtatttgacacatttcgactgattgctaaggaatctggcaaggatagtcaggag
aagaaaaagaatcatatcaagtcactgcttgttgctgccactgactgtgaacctttatat
ctgattagattgctgcagacaaaattgcgaattggacttgctgagcagactcttttagct
gcattaggacaagcagctgtatatgctgaaaagcactcaacaccacctccgaatattcaa
tcccctctagaagaggcttctaagattgtaaagcaggtgttttctatacttccagtttat
gacaaacttgtccctgctcttcttagtggtggtgtgtggaatctttcaaaagcatgcaac
tttacaccgggaattccaattggacccatgctggcaaaaccaacaaaaggagtgtctgag
atcttaaataaattccagggtttggaatttacttgtgaatacaaatacgatggggaacgt
gcccagatacattacatggaagatggttcagttgagatatacagtcgaaatgctgaacgg
aacactgggaagttccctgatgttgttctaacagtatcaaggataaagaaaccatctgta
agatcatttatcttggattgtgaacttgttgcttatgatcgtggaaaacaaaagattcta
ccttttcagattctgagtactcgagctcgtaagaatgtggccgtgagtgatattaaggtt
gaagtgtgtgtatttgcttttgatttactctatcttgatggtcaaccacttatccagaga
gaacttaatgcgcgtcgagagcttctctacgattcatttattgaagaatctggatatttt
caatttgccacagcaataataacaaatgatctcgaggaaatacaaaagttccttgatgca
tcggttgatcaaagctgtgagggtttaatcatcaaaacactgaaccgggatgccacttat
gagccttccaagaggtctcataactggctaaaactgaagaaggattacattgacagcata
ggggattcacttgatttggtaccaattgctgctttccatggccgtgggaaacgtacaggt
gtctatggtgcatttctccttgcctgttatgataatgacaatgaagaatttcaaagtatt
tgtaagataggaactggtttttctgaagcaatgcttgaggaacgttctgctagtctccgt
tctaaagtcatccctcaaccaaagtcgtattatcggtatggagatgcaatcaatccagat
gtttggtttgagccaactgaggtttgggaggttaaagcagcagacttgactattagccca
gtttatcgtgcaggagtcggcattgtggactctgacaagggaatttctctccgatttcca
cgtcttgttcgtgtgaggaaagacaaatatccagaggaagcctcatcatcagagcaggtt
gccgacatgtataatgctcagaaacacaaccaccagaacaatcaagatgacaatgaagac
gactaa

DBGET integrated database retrieval system