KEGG   Cucumis melo (muskmelon): 103503528Help
Entry
103503528         CDS       T03195                                 

Definition
(RefSeq) acetylornithine deacetylase
  KO
K01438  acetylornithine deacetylase [EC:3.5.1.16]
Organism
cmo  Cucumis melo (muskmelon)
Pathway
cmo00220  Arginine biosynthesis
cmo01100  Metabolic pathways
cmo01110  Biosynthesis of secondary metabolites
cmo01210  2-Oxocarboxylic acid metabolism
cmo01230  Biosynthesis of amino acids
Module
cmo_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:cmo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    103503528
Enzymes [BR:cmo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.16  acetylornithine deacetylase
     103503528
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-GeneID: 103503528
NCBI-ProteinID: XP_008465958
UniProt: A0A1S4E5Q2
LinkDB All DBs
Position
Un
AA seq 436 aa AA seqDB search
MGSVKEIIGELNKESFVSLLSKLIGEAEFVQNNPKENLIPQEDKIVNHVLDVLNPYSTAN
GGPLLINHVSYAPGRGNLIVEYPGTVSGKVVSFVGSHMDVVPANPDTWKFSPFSLSVDGD
QLRGRGTTDCLGHVALLTELLKKLAQTKLKLKSSVVIVFIASEEDNSIPGIGAEQLAKEG
YFDNLKGGPLFWIDTADSQPCIGTGGSIPWKLVATGKLFHSGLAHQAINAMELAMEALKV
IQLRFYEDFPPHTMEQAYGFASPSTMKPTQWIYPGGGLNQIPGECTISGDVRLTPFYAVK
DVMKKLQGYVDYINANIEKLDTRGPVSKYVLPNEGIRGRIDITFGEPMSGVACDLNSRGY
KVLHNATKEVIGHVKPYSLTGSLPVIRELQEDGFDVQTAGYGLLDTYHAQNEYCLLSDMG
NGYKIFASIISQLEED
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgggttccgttaaagaaattattggtgaactgaacaaagaatccttcgtctctttactc
tccaagctcatcggagaggccgagttcgtccaaaacaacccaaaagaaaacctgattcct
caagaagataagatcgttaatcacgtccttgatgttcttaacccttacagtactgccaat
ggcggacccttgctaatcaaccatgttagctacgctcctggccgtggaaatttgattgtg
gagtatcctgggactgtatctggaaaagtagtctcctttgttggtagccatatggatgtt
gtccctgccaatcccgatacttggaaattttctccattctcattgagtgttgatggggat
caacttcggggtcgtgggacaactgattgcttaggacatgttgcccttctaactgaactt
ctcaagaagcttgcacaaactaaactaaagttgaagtcctccgttgtcattgtatttatt
gcatctgaagaggacaattctatcccaggaattggagctgaacaacttgctaaagaggga
tactttgataatttaaaaggagggccactattttggattgatacagcagattcacagcct
tgtattggtactggcggttcaataccttggaaacttgtggcaactggaaaacttttccac
agtggtttggcacaccaggctattaatgctatggagcttgctatggaagctcttaaagtg
attcaattacgcttttatgaagattttcctccccatactatggaacaggcatatggattt
gcatcaccatcaaccatgaaaccaacccaatggatttatccaggaggtggtctcaatcaa
attccaggagaatgcactatttcaggagatgtcaggttaacccccttctacgctgtgaag
gatgttatgaaaaaactccaaggctatgttgattacattaatgcaaacattgagaaactt
gatacgaggggtcctgtttcaaagtatgtcttaccaaatgaaggcatcaggggaagaatt
gatataactttcggtgagccgatgtcgggagttgcatgcgatcttaattctcgtggctat
aaagttttacacaatgcaacgaaggaagttatagggcacgtcaaaccttactcacttaca
gggagtttgccggttattcgggagctccaggaggatggatttgatgttcaaactgctggc
tacggtttattagatacataccatgcccagaatgagtattgccttcttagtgatatgggc
aatgggtacaagatttttgccagcatcatctctcaattagaagaagattga

DBGET integrated database retrieval system