KEGG   Cucumis melo (muskmelon): 103503879Help
Entry
103503879         CDS       T03195                                 

Definition
(RefSeq) hexokinase-2, chloroplastic
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
cmo  Cucumis melo (muskmelon)
Pathway
cmo00010  Glycolysis / Gluconeogenesis
cmo00051  Fructose and mannose metabolism
cmo00052  Galactose metabolism
cmo00500  Starch and sucrose metabolism
cmo00520  Amino sugar and nucleotide sugar metabolism
cmo01100  Metabolic pathways
cmo01110  Biosynthesis of secondary metabolites
cmo01200  Carbon metabolism
Module
cmo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cmo_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103503879
   00051 Fructose and mannose metabolism
    103503879
   00052 Galactose metabolism
    103503879
   00500 Starch and sucrose metabolism
    103503879
   00520 Amino sugar and nucleotide sugar metabolism
    103503879
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    103503879
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cmo04131]
    103503879
Enzymes [BR:cmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     103503879
Membrane trafficking [BR:cmo04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    103503879
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 103503879
NCBI-ProteinID: XP_008466487
UniProt: A0A1S3CRD9
LinkDB All DBs
Position
Un
AA seq 488 aa AA seqDB search
MSVAAVGSFSPLRSPTWIARPRFTMAVGSKAVSVSPILTKFQKDCETPLPVLRHVADAMA
NDMRAGLAVDGGSDLKMILSYVDTLPSGNEEGLFYALDLGGTNFRVLRVQLGGKEKRVIA
TEFEQVSIPQHLMFATSQELFDFIASGLEKFVESEGDRFHLSPGRKRETGFTFSFPVKQT
SIDSGILIKWTKGFAVSGVAGKDVVACLNEAMERRGLDMRVSALVNDTVGTLAGARYYDD
DVVAAVILGTGTNACYIEQKDAIPKLPGQGSSSGETIINTEWGAYSNGLPLSVFDREMDA
ASINPGEQIFEKTIAGMYLGEIARRVLLAMAEFSPLFGKSIPEKLSRQFILSTPDLCAMQ
QDVSDDLQAVGSILYNVVGVESDLSARKIVVEVCDTIAKRGGRLAGAGIVGILKKIEDFE
GVKAGKRRVVAMDGGLYENYPQYRKYLKEGVTELLGTELAKNVAIEHTKDGSGIGAALLA
ASNSIYRT
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtcgctgctgttggatctttctctccactaagatctcccacgtggatcgcccgc
cctcgcttcaccatggccgtcggatccaaagccgtctctgtttcccctattttgactaag
tttcagaaggattgcgagacccctttgccggtattgcgccacgtggcggatgcaatggcc
aatgatatgagagctgggcttgctgtcgacggcggcagtgatctgaagatgattcttagc
tatgtcgacactctccctagcgggaatgaggaaggattgttttatgcattggatcttggt
ggcactaattttcgagtgcttagagttcaattgggtggcaaagaaaaacgtgttattgct
actgaatttgaacaagtttcaatccctcaacacttaatgtttgccacatctcaggagcta
tttgatttcattgcttctggtctggaaaaatttgtagagagtgaaggtgacagattccac
ctttctcctggaagaaagagagagactggattcacattctcattccctgttaaacaaact
tccattgattctggcatattaatcaagtggactaaaggttttgctgtttctggagtggct
gggaaagatgttgttgcttgtctaaatgaagccatggaaaggcggggactagatatgcgc
gtttcggcccttgttaatgatacggttggaaccttggctggagcaagatattatgacgat
gatgtcgtggctgctgttattttaggtacaggaaccaatgcctgttatatagaacaaaag
gatgctattcctaagctgccaggccagggatcttcttcaggggaaacaattattaacaca
gaatggggagcatattcaaatggtcttcctctctctgtttttgatagagagatggatgct
gctagtatcaatccaggggagcagatctttgagaagacaatagctggaatgtacctcggt
gaaattgctcgtagagtacttttagcaatggctgaattctcccctctttttggcaaatcc
attcccgaaaagctgtcaaggcaattcatccttagcacaccagatctatgtgctatgcaa
caagatgtctctgacgaccttcaagcagtcgggtcaattttgtacaacgttgtcggggtc
gagtcggatttaagcgcaagaaaaattgtcgtagaggtgtgtgacacaattgcaaagcga
gggggacgattagcaggggcgggaattgtaggcatcctgaagaaaatagaagattttgaa
ggtgtaaaggctggaaagaggagagttgtggccatggatggaggattgtatgagaattat
ccacagtacagaaagtaccttaaagaaggggtaacagaacttctggggacagagttggct
aaaaatgtggccattgaacatactaaagatggatctggcattggggctgctcttttggct
gcttcaaactctatttatagaacatga

DBGET integrated database retrieval system