KEGG   Cucurbita moschata (crookneck pumpkin): 111432560Help
Entry
111432560         CDS       T05248                                 

Definition
(RefSeq) fatty acid amide hydrolase-like isoform X1
Organism
cmos  Cucurbita moschata (crookneck pumpkin)
SSDB OrthologParalogGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-GeneID: 111432560
NCBI-ProteinID: XP_022925273
LinkDB All DBs
Position
Unknown
AA seq 609 aa AA seqDB search
MDLFNSRGVAYKPAKDVDLSPTSSEFYLTANVKAPRMVGIVVKIFAWVLEMRILGKLLLY
VLKANNLIYKLVGNAEIEESPVFLPSHPVEEKENEEVKYIGVALSETEQVQEAVSCLPSW
SDTEVDSLNPSFHRWTIMDYSTAYRSRKITPLTVAERFIAAVSESSKPPLNMSFFINYNV
EDILKQAAESTNRYEHGQPLSVLDGVPIAVKDEIDCLPYPTTGGTSWLHKLRPCTSDASC
IRYLRLCGALIVGKTNMHELGIGTSGINPHHGSTRNPYNTSRICGGSSSGSAAVVAAGLC
PAALGVDGGGSVRIPASLCGVVGLKPTFGRVPHSGVLPLNWTVGMVGILAATIEDAFIVY
AAISSKIPSHQNAILPKLCFPLLNTSRPIPSVTMAKYGEWFNDCSDDIRICCSNALDKLQ
KHHGWKMVEVTIPEIEVMRLAHYSTIASECSTALSSYLEKLDSSQLGWDARVALAVYGSF
GSKEYIKAQKIRNRQMYFHRKILAHADVIVSPTTGVTAYPILNDALKTGELDYINGAALV
RYSIAGNFLGLPAVTVPIGYDKTGLPIGLQFIGKPWCEATLIHIAYAMQALCVADYKKPE
VFYDLLTQK
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atggatttgttcaattctcgtggggtggcttacaagcctgccaaagatgtcgatttgagt
cccaccagctctgaattctacctcacagccaatgtcaaagctcctcgaatggttggaata
gtggtgaaaatatttgcgtgggtcctagaaatgaggattttggggaaattgctgttgtac
gttctcaaggccaataatctcatttacaagctcgttggaaatgcggagatagaagaatcg
cctgtttttttaccctcgcatcctgtagaagaaaaagaaaatgaggaggtgaagtacata
ggcgtggctctgtctgaaacagaacaagttcaagaggcagttagttgtctgccttcatgg
tcagacacagaagtggattccttaaacccttcatttcacagatggacaataatggactat
tcaacagcatatcgttcaagaaaaataactcctctaactgttgcagagagattcatagca
gctgtgagtgaatcatccaaacctccattgaacatgtcattcttcattaattataatgtc
gaagacattctcaagcaagcagctgaatcaactaatcgttatgagcatggacaacccctt
tcagttctagatggagtgccaattgctgtcaaggatgaaatagattgtctaccatatcca
acaacaggggggacgagttggttgcacaaactaagaccttgtaccagtgatgcaagctgc
atacgatacctcaggttatgtggagctctaattgttggtaaaaccaatatgcatgaactt
ggtattggaacaagtggaataaaccctcatcatgggtcgacgagaaatccgtataatacg
agcaggatatgtggaggttcttctagcggatcggctgcggttgttgctgcaggactatgt
cctgctgctttaggtgttgatggaggaggatctgtgagaatccctgcatctctttgtgga
gttgtcggtctgaagccaacatttgggcgtgttcctcattctggtgttcttcctctgaat
tggactgttgggatggtagggatactggctgccacgattgaggacgcgtttattgtttat
gcagccataagcagcaaaattccttcgcatcagaatgctatactgcccaaactttgtttc
ccattactgaacacatcaagaccaataccttcggttacaatggcaaagtatggtgagtgg
tttaacgactgcagtgatgatatcagaatttgctgttctaatgccttggacaaacttcaa
aaacatcatggctggaagatggtcgaggtgacgattcccgagatagaagtgatgcgttta
gcacattattcgacaattgcatccgaatgcagcactgcattgagttcttatctcgaaaag
ctggattcctcacaactaggatgggatgcaagagtagcacttgctgtttatggctctttt
ggtagtaaggagtacataaaagctcagaagattaggaatcgccaaatgtattttcatcgg
aaaatactagcacatgctgatgtcatcgtgtcaccgacaaccggtgtaactgcttaccct
atcttgaatgatgctctcaagactggagaacttgactacattaatggagctgcacttgtt
agatactcaatagctgggaacttccttggattgcctgcagtaactgttccaattggatat
gataaaactggtttgccaattggcctccagttcattggcaagccttggtgtgaagcaacg
ctcattcatatagcatatgcaatgcaggctctctgtgttgctgattacaaaaagccagaa
gttttctacgatcttctgacacaaaaatag

DBGET integrated database retrieval system