KEGG   Cucurbita moschata (crookneck pumpkin): 111434234Help
Entry
111434234         CDS       T05248                                 

Definition
(RefSeq) alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
cmos  Cucurbita moschata (crookneck pumpkin)
Pathway
cmos00052  Galactose metabolism
cmos00500  Starch and sucrose metabolism
cmos01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmos00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    111434234
   00500 Starch and sucrose metabolism
    111434234
Enzymes [BR:cmos01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     111434234
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 BON
Motif
Other DBs
NCBI-GeneID: 111434234
NCBI-ProteinID: XP_022927400
LinkDB All DBs
Position
Unknown
AA seq 916 aa AA seqDB search
MATGSKSLQAFLRRRRLLSAVVLFLFTCFFRLTASLPFAAGEQRENSAVGYGYRVRSGRV
DPTGKSLTADLDLIDKSSVYGPDVERLSLQASFETKDRLRVRITDSNRERWEVPDEIIPR
RSNSRIRSLPERDVGSPETSVISDPASDLIFSLHDTAPFGFSVHRRSSGDVLFDTSPNFS
DSETFLVFKDQYIQLSSSLPKDRSSLFGIGEQTRKSFKLVPDKSKTLTLWNADIGSVNTD
VNLYGAHPFYIDVRSPSRDGKVAAGTTHGVLLLNSNGMDIIYTGDRISYKAIGGIIDLYF
FAGPSPISVIDQYTELIGRPAPVPYWSFGFHQCRYGYKNVSDIETVVARYAKAGIPLEVM
WTDIDYMDGYKDFTFDPINFPVEKMKNFVDNLHQNGQKYVLILDPGISTNKTYGTYIRGI
EADIFIKYDGVPYLGEVWPGPVYFPDFLHPNSEIFWGDEIKLLRDIVPFDGLWIDMNEIS
NFITSSTSSFSNLDNPPYKINNAGVQRPINNRTVPASSLHFGNLTEYNTHNLYGFLESKA
THASLVKVTGKRPFVLSRSTFVGSGKYTAHWTGDNAATWNDLGYTIPSILNFGLFGIPMV
GADICGFSGDTTEELCRRWIQLGAFYPFARDHSDKGSIRQELYLWDTVAASARKVLALRY
SLLPYIYTLMYEAHKKGTPIARPLFFSFPQDIRTYEINSQFLLGAGVLISPVLKEGAISV
DAYFPAGNWFSLFNYSESVAIKSGQQITLDAPADHINVHVREGNILALHGEATTTQAARK
TEFKLLVVVSNGQSSSGEVFLDDGEEMEMGEEGGNWSLVRFYSEAVGSKLLIKSQVINGG
FALSQKMIIDKVTIVGFERPKNMGDLGLDISKGANLNGNSGIRITYEYSAKFVNVQISGL
SIPICEGFVMELSSLN
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
atggcgactggttccaaatctctccaagcttttctccgtcgccgtcgtttactctccgcc
gtcgtactcttccttttcacttgcttctttcgtctaactgcatctctcccgttcgccgcc
ggcgagcagagagaaaactcggccgtcggatatggataccgagttagatcggggcgtgtt
gaccctaccggaaagtcgttgaccgccgatcttgacctgatcgacaaatcctcggtgtat
ggacctgacgttgagagacttagcctccaagccagttttgaaaccaaagatcggctgaga
gtgcgaataacagactcaaatcgggaacgatgggaagtaccggacgagataattccccgt
cgatcgaactcccgtatccgctccctgccggaaagagacgtcggctcaccggaaacctct
gtcatctccgatccggcttccgatctcattttcagcctccatgacaccgcaccgttcggc
ttttccgtgcaccggcgatcatctggcgatgtcctcttcgacacatcgcctaatttctcc
gattcggagacttttcttgtcttcaaggaccaatacattcaactatcctcttcgcttccc
aaggacagatcgtctttgtttggcattggcgagcaaaccaggaagtcgttcaagctcgtg
ccggataaaagtaaaactttgacgctttggaacgccgatatcggtagtgttaatactgac
gtgaacctctacggtgctcatcccttctacattgacgtccggtcgccgtctcgcgatggt
aaagttgcggcagggacgacgcatggagttctgttactgaacagtaatggtatggatatt
atatacactggagataggattagctacaaggctattggtggaatcattgatttatacttc
tttgcgggtccgtcaccgatatcagtgatagatcagtatacggagcttattgggcggcct
gcacccgtgccttattggtcgttcggttttcaccaatgtcgttatggctacaagaatgtt
tctgatattgagactgtagttgctcgttatgccaaagccggcatacctcttgaagttatg
tggacagacattgattacatggatgggtataaggacttcacttttgatcccatcaatttt
cccgtggagaaaatgaagaactttgttgataatcttcatcaaaatggacaaaaatatgtg
ctcatcttggatcccggtattagtacaaacaagacatatggaacatacatccgagggata
gaagctgatatctttataaaatatgacggggttccatacttgggtgaggtttggcctgga
cctgtttacttccctgattttcttcatccaaacagtgagattttctggggtgatgagatt
aaattacttcgagatattgttccgtttgatggtctttggattgatatgaatgagatatca
aattttataacctcttcaaccagctcattttctaatcttgataaccctccttacaagatt
aacaatgctggagtccaacgtccaattaacaataggactgtgccagcatcaagtcttcat
tttggtaacttgacagagtataatactcataacttatatggtttcttggagtcaaaggct
actcatgcctcattagtaaaagtaacgggcaaaagaccatttgttctgtcaagatcaact
tttgtaggctctgggaagtacacagcacattggactggagataatgctgcgacttggaat
gatttaggttacacaattccatccattttgaactttggactctttggaattccaatggtt
ggtgctgacatatgtggattttctggagatacgacggaagagctttgccgacgttggatt
cagttaggtgcattttacccatttgctagagatcattctgacaaaggatccattcgtcaa
gagctttatctttgggatacggttgctgcatcagccaggaaggtgcttgcacttcgttat
agcttacttccttacatctacactttgatgtatgaggcacacaaaaaggggacaccaatt
gcacgccctctcttcttctcattccctcaggatatcaggacctatgaaatcaactcccag
tttctacttggagcaggtgtattgatttctccagttctgaaggagggagctatttctgtt
gatgcatattttcctgcaggaaactggtttagcctctttaactattctgagtcagtggct
ataaagtcagggcagcaaatcactctagacgcacctgctgatcatataaatgtgcacgtc
agggaaggaaacatattagcattacacggagaggcgacgacaacacaagcagctcgaaag
acagagttcaagcttttggtagtcgtcagcaatggtcaaagcagctctggagaggtgttc
ttggatgatggagaagagatggaaatgggagaagagggaggtaattggagtctggtaaga
ttttacagtgaagcagttgggagtaagttactgatcaaatctcaggttataaatggagga
tttgctttgagccagaagatgatcattgacaaggtgaccattgtaggctttgaaaggcct
aagaacatgggtgaccttggtttagatataagcaagggcgcaaacttgaatggtaattca
ggcatcagaataacgtatgagtactctgccaagtttgttaatgtccagatctcgggcttg
tccattcctatatgtgagggattcgtaatggagttgtcatcattaaattga

DBGET integrated database retrieval system